KEGG   Ficedula albicollis (collared flycatcher): 101812633Help
Entry
101812633         CDS       T02815                                 

Gene name
MARS2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00450  Selenocompound metabolism
fab00970  Aminoacyl-tRNA biosynthesis
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101812633 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101812633 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fab01007]
    101812633 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fab03016]
    101812633 (MARS2)
Enzymes [BR:fab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101812633 (MARS2)
Amino acid related enzymes [BR:fab01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101812633 (MARS2)
Transfer RNA biogenesis [BR:fab03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101812633 (MARS2)
 Prokaryotic type
   Other AARSs
    101812633 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 101812633
NCBI-ProteinID: XP_016153820
Position
4A
AA seq 529 aa AA seqDB search
PLSPRGSGLSPRPLSVSGTDEHGLKIQQAAAAAGTSPAELCQRVSGLFRQALTRAGVAYT
DFIRTSEPRHQRAVRHFWGALGDAGVLYKGSYEGWYCTPEESFLPESQLAERTDSQGRPC
KVSLESGHEVHWTKEENYMFRLSAFRDPLQNWLRDNPRAIVPQPFYQRVLRWLDGDLPDL
SVSRERSRLHWGIPVPGDPSQTIYVWVDALVNYLSVLGYPEGHGPWWPAAHHVVGKDILK
FHALYWPALLLAAGLQPPERILVHSHWTVRGQKMSKSLGNVVEPGPCVGRFGVDGFRYFL
LRQGVPERDCDYYEEKVVKLVNSELADALGGLLNRSTAPSINPSNTYPRFSEPCFPKVLD
CREPKGAGRACAEDYELVAAVAALPAQVDGYFQSFQIYKALECIAQCVRQTNGFFQRHRP
WKLERREAGERLWLDTVLHVTLECLRVYGTLLQPVVPRAADKLLSRLAVGPGERGLSGLT
FLPRYDGKPCPFEGRQLGPDTGVLFHRLGKLETGKKRKQEAQVPDKQLL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
cccctgtccccgcgaggctccgggctctccccacggcctctctccgtttcagggacggac
gagcacgggctgaagatccagcaggcggcggccgcggcggggacctcgcccgccgagctc
tgccagcgcgtctcggggctgttccgccaggcgctgacccgcgccggcgtcgcctacacc
gacttcatccgcaccagcgagccgcggcaccagcgagccgtgcggcatttctggggcgcc
ctgggcgatgcgggggtgctctacaagggctcctacgagggctggtactgcacgcccgag
gagagcttcctgcccgagagccagctggccgagcgcaccgacagccagggccgcccctgc
aaggtgtccttggagagcggccacgaggtgcactggaccaaggaggagaattacatgttc
aggctctcagcgttccgggatcccctgcagaactggctcagggacaacccccgtgccatc
gttccccagcccttctaccagcgcgtgctgcgctggctggacggggacttgccggacttg
tcggtgtcccgcgagcgcagccggctgcactggggcatccccgtgcccggtgaccccagc
cagaccatctacgtctgggtggacgccctggtgaactacctgagcgtgctgggctacccc
gagggccacgggccgtggtggccggcggcgcaccacgtggtgggcaaggacatcctcaag
ttccacgcgctctactggccggcgctgctgctggcggcggggctgcagccccccgagcgc
atcctggtgcactcccactggactgtcaggggccagaagatgtccaagagcctgggcaac
gtggtggagcccggcccgtgcgtggggcggttcggcgtggacgggttcaggtacttcctg
ctgcggcagggcgtccccgagagggactgtgactactacgaggagaaggtggtgaagctg
gtgaactcggagctggcagacgcgctcggggggctgctgaatcgctcgacggcccccagc
attaaccccagcaacacctacccccgcttctcagagccctgcttccccaaggtcctggac
tgcagggagcccaagggcgcgggcagggcgtgcgccgaggactacgagctggtggccgcg
gtggccgcgctgcccgcgcaggtggacggttatttccaaagcttccagatctacaaggct
ttggaatgcattgcccagtgtgtgaggcagaccaacggcttcttccagaggcacaggcct
tggaagctggagcggagggaggccggggagcggctgtggctggacaccgtcctgcacgtg
acgctggagtgcctgcgcgtctacgggacgctgctgcagcccgtggtgccgcgcgcggcc
gacaagctgctgtcccgcctggctgtggggccgggggagaggggcctctctggcctgacc
ttcctgccacgctacgacggaaagccgtgtccctttgagggcaggcagctcggacctgac
actggcgtcttgttccacaggctgggcaagctggaaactgggaagaagagaaagcaagaa
gctcaagtccctgacaaacagcttctgtga

DBGET integrated database retrieval system