KEGG   Ficedula albicollis (collared flycatcher): 101814213Help
Entry
101814213         CDS       T02815                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fab01002]
    101814213 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101814213 (ABHD12)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101814213 (ABHD12)
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101814213 (ABHD12)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101814213 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S9 Peptidase_S15 Abhydrolase_2 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 101814213
NCBI-ProteinID: XP_005042840
UniProt: U3JDG9
Position
3
AA seq 385 aa AA seqDB search
MRKRNESVTVEHERAAAAAVPGPLDKGCSLRRSLRLPASAAAEGMKRPLGRRYGLWFRLR
KLILWLLGVYIAIPFLVKLCPAIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPE
EDVTIGVWHTVPAALWKNARGKDQLWFEEALGSSHPVILYLHGNAGTRGGDHRVELYKVL
SSLGYHVVTFDYRGWGDSIGSPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVAT
NLVRRLCERETPPDALILESPFTNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFA
NDENVKYISCSLLILHAEDDPVVPFHLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHK
YIYRSPELPRILREFLGKSEHEHHH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgcaacgagtccgtcacggtggagcatgagcgcgccgccgctgccgccgtg
cccgggcccctcgacaagggctgcagcctgaggcgaagcctgcgcctgcctgcctccgcc
gccgccgagggcatgaagcgaccgctgggcaggcgatacggattgtggttccgattgagg
aagttaatactctggttgctgggagtgtacatagccatcccatttctagtaaaactttgc
cctgctattcaggcaaagctggtcttcctaaactttgtgagagtcccatatttcattgac
ttgaaaaggccacaggatcaaggtttaaaccacacctgtaattattacttgcagccagag
gaggatgtaaccattggagtctggcacacggtccctgcagccttgtggaagaatgcccga
gggaaggaccagctgtggttcgaagaggctttgggctccagccaccctgtaatcctttac
ctgcacggcaacgcaggaacaagaggaggggatcaccgggtggagctttacaaggttctc
agctccctcgggtaccacgtggtgacatttgactatcgaggctggggtgactcaataggc
agcccgtcagagaggggaatgacctacgacgcccttcatgtctttgactggataaaagca
cggagtggagacaaccctgtctatatatggggacactccctgggcacaggggttgcaaca
aatctggtgcggcgcctctgcgagagagaaacacccccagatgccctgatcctggaatct
ccattcaccaacatacgggaggaggcacggagtcaccccttttctgtgatatacagatac
ttccctgggtttgactggttcttccttgaccccatcacgacaagtggaattaaatttgca
aacgatgagaatgtgaaatacatttcctgctccctactcatccttcatgctgaggatgat
ccagtggtaccatttcatctgggaaaaaagctttacaacatcgcagccacatcgcggagt
ttccgggactacaaggtgcagtttgtgcccttccacacagacctcggctaccggcacaag
tacatctacaggagtccagagctacctcggatactgcgggaattcctgggaaaatctgaa
catgagcatcatcactga

DBGET integrated database retrieval system