KEGG   Ficedula albicollis (collared flycatcher): 101814267Help
Entry
101814267         CDS       T02815                                 

Gene name
SEPHS1
Definition
(RefSeq) selenophosphate synthetase 1
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00450  Selenocompound metabolism
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101814267 (SEPHS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fab03016]
    101814267 (SEPHS1)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     101814267 (SEPHS1)
Transfer RNA biogenesis [BR:fab03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    101814267 (SEPHS1)
 Prokaryotic type
    101814267 (SEPHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 101814267
NCBI-ProteinID: XP_005039130
UniProt: U3JGT1
Position
1A
AA seq 392 aa AA seqDB search
MSVRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAV
MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
NMLMLLGISNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVC
QPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQVATQNVNPTPGATS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcgggagtcctttaacccagaaagttacgaactggacaagagcttccgtctg
acccgattcactgaactgaagggcacaggctgcaaagtgccgcaggatgtcttacagaaa
ctgctcgaatctctacaggaaaaccattttcaggaagatgaacagttcttgggggcagtt
atgcccaggttgggaattgggatggacacttgtgtaattccattaagacatggaggtttg
tcattagtccaaaccacagattatatttatcctattgtggatgacccttatatgatggga
cgaatagcgtgtgccaatgtcctaagtgacctttatgccatgggggtcacagaatgcgac
aacatgttgatgctccttggaatcagcaataaaatgacagatagggaaagagacaaagtg
atgcctctaattatccagggtttcaaagatgcagcagaagaggcaggaacatctgttact
ggtggccaaacagtgttaaatccctggattgttttaggaggagtggccacgacagtctgt
caacctaatgaatttataatgccagacaatgcagtgccaggagatgtgcttgtattaact
aaaccgttgggaacacaagtggctgtagctgtccaccagtggctagatattcctgaaaag
tggaataaaatcaaactcgtggtaacacaggaagatgtagaactagcataccaggaggca
atgatgaatatggcgcggctgaacaggacagctgctggactgatgcacactttcaatgca
catgcagctacagacatcacgggattcgggatcctggggcatgcacaaaaccttgccaag
cagcagcgaaacgaggtgtcctttgttattcacaacctccctgtcctggctaagatggct
gctgtcagtaaggcctgtggcaacatgtttggcctcatgcacgggacttgtccagaaact
tcaggaggcctcctcatctgcttaccacgagagcaggcagcgcgtttctgcgccgagatc
aagtccccgaaatacggcgaaggccaccaggcgtggattattggcattgtagagaagggc
aaccgcacggccaggattatagacaaaccccggatcattgaagtggcaccacaggtggcc
actcagaacgtcaaccccacgcccggtgccacctcttaa

DBGET integrated database retrieval system