KEGG   Ficedula albicollis (collared flycatcher): 101814682Help
Entry
101814682         CDS       T02815                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101814682 (ABHD6)
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S33
   101814682 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 UPF0227 Thioesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 101814682
NCBI-ProteinID: XP_016156909
UniProt: U3K0V4
Position
12
AA seq 337 aa AA seqDB search
MDLDLLNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRALGMQVRYANYDDYQF
CYSYRGRPGYRPSILMLHGFSAHKDMWLSIVKFLPKNLHLICVDMPGHEGTTRSDLDDYS
ISGQAKRIHQFVECIKLNKKPFHLVGTSMGGNVAGVYAAQYPEDICSLTLICPAGLPSTT
DSKFIKQLRELQESKRIDRIPLIPSTPEEMAEMLKLCSYVRFKVPQQILQGLVDVRIPHN
EFYRKLFLEIVDEKSRHSLHENMSKIKAPTQVIWGKQDQVLDVSGASVLAGAIPDCHVYI
LENCGHSVVVERPRKTANLILEFLALLHSIDNNKKQA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggacctggatttgctgaacatgtttgtcatcgctggtggcactctggccatccccatc
ctggcctttgtggcctcattcctcctctggccctcggcgctcatccgcatctactactgg
tactggcgccgagccttgggcatgcaggtcagatatgcaaactacgatgactatcagttt
tgttattcctatagaggaaggcctgggtaccggccgtccatcctgatgttacatgggttc
tcagcccacaaagacatgtggctgtccatagtcaagttcctgccaaagaacctgcacttg
atatgcgtggacatgcctgggcacgagggcacgacccgctcggacttggatgattactcc
attagtgggcaagctaagagaatacaccagttcgtggagtgcatcaagctgaacaaaaag
ccctttcatctggttggcacttccatgggggggaatgttgctggcgtctacgctgctcag
tacccagaagatatttgcagcctgaccctcatctgtcctgcaggcctgccaagtaccaca
gacagcaagttcatcaagcagctgcgggagctgcaggagtccaaacgcattgacaggatc
cctttaatcccctccacgcccgaggagatggcagagatgctgaagctttgctcctacgtt
cgcttcaaggtgccacagcagatcctccagggcctcgttgacgttcgcatcccacacaat
gaattctaccgcaaactgtttttagaaatcgtggatgaaaagtccaggcactctctccat
gagaacatgagcaagatcaaagcaccgacacaggtcatctggggaaagcaggaccaggtc
ctggacgtgtctggtgccagtgttttagcaggtgctattccagactgccatgtgtacatc
ctggagaactgtgggcactctgtggtggtggagcggccccgcaagacagccaacctcatc
ctggagttcctggcgctgctgcacagcatagacaacaacaagaagcaggcatga

DBGET integrated database retrieval system