KEGG   Ficedula albicollis (collared flycatcher): 101814739Help
Entry
101814739         CDS       T02815                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00020  Citrate cycle (TCA cycle)
fab00640  Propanoate metabolism
fab01100  Metabolic pathways
fab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101814739 (SUCLG1)
   00640 Propanoate metabolism
    101814739 (SUCLG1)
Enzymes [BR:fab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101814739 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101814739 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 101814739
NCBI-ProteinID: XP_005045683
Position
4
AA seq 323 aa AA seqDB search
FVLSSLFFPVQQNGVRHCSYTASRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGTNLV
GGISPGKGGKTHLGLPVFNSVKEAREKTGASATVIYVPPPFAAAAITEAIDAEMPLVVCI
TEGIPQQDMVRVKHRLLRQSKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSG
TLTYEAVHQTTQVGLGQSICVGIGGDPFNGTNFIDCLDVFLKDPNTEGIILIGEIGGNAE
EDAAAFLKENNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAGV
VVSMSPAQLGSTIYKEFEKRKLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
tttgtgctctcttctcttttctttccagttcaacagaatggagtccgacactgctcctac
acagcatccagaaaaaacctgtatgttaacaaaaacacaaaggttatctgtcagggtttt
acaggcaaacagggcacctttcacagccagcaggcattggactatggcaccaatctagtt
ggaggaatttctccagggaaagggggaaaaactcatctaggtctgcctgtgtttaattct
gtgaaggaggccagagaaaaaacgggtgcttcagccactgtcatctacgtccctcccccg
tttgctgctgctgccatcaccgaggccatcgatgcagagatgcccctggtggtttgcatc
accgagggcatcccccagcaggacatggtgcgggtcaagcaccggctgctgcggcagagc
aagacccgcctggtgggccccaactgccccggggtcatcaatcctggagaatgtaaaatt
ggtatcatgcctggtcacattcacaagaaaggaagaattggtattgtgtcaagatctgga
accctgacatatgaagctgttcatcagacaacacaagttgggttggggcagtctatttgt
gtaggtattggaggcgatcccttcaatggaactaattttattgactgccttgatgtcttc
ctgaaggatcctaatactgaggggatcatactgattggggagattggaggaaatgctgaa
gaagatgcagcagcatttttaaaggaaaataattctggccccaacgccaagcccgtggtg
tccttcatcgccgggctgacggctcctccgggccggcggatgggccacgctggagccatc
atcgctgggggaaaggggggagccaaggagaagattgcagccctccagagtgcaggggtt
gtggtcagcatgtcccctgcccagctgggcagcaccatctacaaggagtttgagaaaaga
aaattgctgtga

DBGET integrated database retrieval system