KEGG   Ficedula albicollis (collared flycatcher): 101814972Help
Entry
101814972         CDS       T02815                                 

Gene name
DHX8
Definition
(RefSeq) DEAH-box helicase 8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:fab00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101814972 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fab03041]
    101814972 (DHX8)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101814972 (DHX8)
Spliceosome [BR:fab03041]
 Complex C
  Other components
   Step II factors
    101814972 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 PRP38_assoc Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 ABC_tran Transformer Spem1
Motif
Other DBs
NCBI-GeneID: 101814972
NCBI-ProteinID: XP_016159869
UniProt: U3JDI3
Position
27
AA seq 1113 aa AA seqDB search
MRPPAKPSTSKEAVVKPKSEKEKLRELYPALCRPDNPNIRNMLDEDDVKVAADALKELEA
LMPSADRQGKQRSSDHRVKKRKRSRSRSRDRKRRHRSRSRSRSRTWDRNRGKSRYRSRSR
SWSPSKDRRDREKYLEKSHERWRDKHIDRPPAEEPSIGDIYNGKVTSIMQFGCFVQLEGL
RKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQDTGEDLN
PNRRRNLVGETNEETSMRNPDRPSHLSLVNAPEVEDDSLERKRLTRISDPEKWEIKQMIA
ANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKN
PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNTHWVDPLPDVDGRQIAANMRG
IGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRESLPIFRLKEQLIQAVHDNQILIVI
GETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIR
FEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQK
RQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQI
HLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDP
APPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQR
AGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMD
APPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLT
IVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFI
QARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTL
IDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPT
KLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctccagcaaaaccatccacgagcaaagaggcagttgtcaaacccaaatcagag
aaagaaaagttgagggaattgtatccagccctttgcaggcctgacaatcccaacatcagg
aatatgctggatgaagatgatgtgaaagtggcagctgatgccctgaaagagctggaagct
ctgatgcccagtgcagacaggcagggaaagcagaggagcagcgaccatcgggtgaagaaa
aggaagaggagccgaagccgtagcagggacaggaagcgaaggcacagatctcgctccagg
tctcgttccaggacttgggataggaacaggggaaaatccagatacaggtcaaggagcagg
agctggagtcccagtaaggaccgcagggatcgagagaagtaccttgagaagagccatgag
aggtggagagacaagcacatagaccgtcccccagctgaggaaccttccattggagacatc
tacaacggcaaagtcaccagcataatgcagtttggatgctttgtgcagctggaaggactg
aggaaacgttgggaaggcttggtgcacatctcagagctacgaagggaaggacgtgttgcc
aatgttgctgatgttgtgagcaaaggacaaagagtgaaagtcaaagtgttatcttttact
ggatccaaaaccagcctgagcatgaaggatgttgatcaagacactggggaagatttaaac
ccaaaccgtagaaggaacctggttggagaaaccaatgaagaaacgtccatgaggaaccca
gacaggcccagtcacttgtccctggtgaatgcccccgaggtggaggatgacagcctggaa
cggaaacgcctcacccggatttcagacccagagaagtgggagatcaaacagatgattgca
gctaatgtgctttccaaggaagagtttcctgactttgatgaagagactgggattcttcct
aaagttgatgatgaagaagatgaagatcttgagattgagctagttgaagaagagccacca
tttcttcgaggtcacactaaacagagcatggatatgagtcccattaaaatagtaaagaat
ccagatggttccttatcccaggctgcaatgatgcaaagtgctttagccaaagagaggaga
gagcttaaacaagcccagagagaagcagagatggattccatccccatgggcctcaacaca
cactgggtggatcctctccctgatgtggatggaagacaaatagctgcaaacatgcgaggt
attgggatgatgccaaatgatatcccagagtggaagaaacatgcgtttggtggcaacaaa
gcttcttatggtaagaagacacagctttccatcattgaacagagggagagtctcccaatc
ttcagactgaaggagcagctgatacaagctgtgcatgacaaccagattctgattgttatt
ggagagacaggatctgggaaaacaacccagattacccagtacctggctgaggcaggatac
acctcaagaggaaagattggatgtactcagcctcgcagagtggctgcaatgtctgttgca
aagagggtgtcagaggaatttggttgctgcttgggacaagaggttggctacaccattcga
tttgaggactgcaccagtcctgagactgtcatcaaatacatgacagatgggatgttactg
agagagtgcctgatagacccagatctcacccagtatgccattatcatgctggatgaggcc
catgagaggaccatacacacagatgtgctctttgggctcctgaaaaagacagtgcagaaa
cggcaggacatgaagttgatagtgacatcagcaacactggatgctgtgaaattctctcag
tatttctatgaagcaccaatcttcacaattcctggcagaacatacccagtagaaattctg
tacacgaaagagccagagacagattatttggatgccagtctgattacagtaatgcaaatc
catttaacagagccaccaggtgacattttggtctttctgactggccaggaagagattgac
actgcctgtgaaatcctctatgagaggatgaaatctctaggacctgatgttccagagtta
attatcctaccagtatattcagctttgcccagtgaaatgcagacaaggatctttgaccct
gccccaccagggagcagaaaggttgttattgccaccaacattgcagagacatctttgact
attgatggcatatattatgtggttgatcctggctttgtgaagcagaaagtttataactcc
aagactggaattgaccaactggtggtgacaccaatttcccaggctcaagccaagcagcgt
gcaggaagggctgggagaacaggcccaggaaaatgctacaggttatacacagaacgtgca
tatagggatgagatgctaaccaccaatgtgcctgaaatccagagaacaaatctggccagt
acagtgctctccctgaaggctatgggcatcaatgatttgctgtcctttgactttatggat
gctccccccatggaaactctcatcactgccatggagcagctctacaccctgggagctctg
gatgatgaggggctgctcactcgacttgggcgcaggatggcagaattccccttggagcct
atgctgtgtaagatgttgatcatgtctgtgcatctgggatgcagtgaagagatgctgacg
attgtgtccatgctgtctgtgcagaatgtgttctacaggccaaaggataaacaagcactt
gctgatcaaaagaaagccaagttccatcaaacagaaggtgaccacctcaccctgctggct
gtgtacaattcctggaagaataataagttttcaaatccctggtgctatgaaaattttatc
caggccagatccttacggcgggcacaggacattcgcaagcagatgttggggatcatggac
aggcacaagctggatgtggtgtcctgtgggaaggcaacagtccgggtgcagaaggccatt
tgcagtggcttcttccgaaatgcagcaaagaaggatccccaggaagggtataggacactt
attgaccagcaggttgtctatatccacccatccagtgctctcttcaacaggcagcctgaa
tgggtggtgtatcacgagttggtgctgaccaccaaggagtacatgcgggaggtgacaacc
atcgatccccgctggctggtggagtttgccccagctttcttcaaggtctctgacccgacc
aagctgagcaagcagaagaagcagcagaggctggagccgctgtacaaccgctacgaggag
cccaacgcctggcgcatctcgcgggcattccgccgccgctga

DBGET integrated database retrieval system