KEGG   Ficedula albicollis (collared flycatcher): 101815383
Entry
101815383         CDS       T02815                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fab03000]
    101815383 (AHRR)
Transcription factors [BR:fab03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101815383 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 101815383
NCBI-ProteinID: XP_005041882
Position
2
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQAGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVRAKHKADDTAAAITN
SSSKGTSGLCEATELYGRNNHHEGAAFTNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILSGFASLKGNLEGLSYNSAIETLGQ
WKHLNWATVKNEQDNVKVKFEPHTNGECFTQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMSQRMNTCPNRRAASFYNRDQNFLNLASTCPSHWGSAENGQSYSGLPQRCAESYVTD
HLKLQRPLISSESLYDTAIPLETPIKTEYDSDSENIADNYLLSQSRAWPDESGSVRKQLS
SYPSRMHLKTEPDLCEPALPCQKPRHCLYTPHNWQCIIANHPNNLSLNRACKGSRNRDAT
SFCPQNSSVCLESTPDLPHMACYSHFYSPSPGEEKEQVNEVFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNRAHVSFPESTLAGPVPHKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctgtatgctgggaggaaaaggaggaaacccattcaaaaa
caaaggcctgcagttgggaatgagaaatcaaatccttccaagagacacagagaccgtctg
aatgcagaactggaccacctggccagcctcctccctttccctcctgacatcgtgtcaaag
ctggacaagctttctgtcctgcgccttagcgtcagctatctccgagtcaaaagtttcttc
caagccattcaagaaaagcactttaagaagcaagctggccaaacgataaaagaagacaat
atatctaacaagactgctgttcaagaaggtggacttctactagaatcactgaatggtttt
gccttggtggtgagtgcagatggaatgatattctatgcgtcatcgacaattgtggactat
ctggggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcacgtggat
gaccgccaggatttttgtagacaactgcattgggccatgaatcctccccagatgctgtct
ggacagcaactacagtcagaaacaggagaagaatatattctcagtaaattgttcaaagca
caagagaatgacagtatgacaacagattattcttcctttttaactcgatgtttcatctgt
cgagttcgctgcttgttggacagtacttctggatttcttacaatgcagttccaaggcaaa
ctaaagttcctcttcggacaaaggaagaagtcctcatcaggaacagtactgccacctcag
ctgtccttattctgcatagtggtaccacttctgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgagagcaaaacacaaagctgatgacacagcagcagcgatcacgaac
tccagttcaaaaggcacttcaggactgtgtgaagcaacagaattatatggaagaaacaat
caccatgaaggtgccgctttcactaatgcattacagattgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttccttagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagagtatgtcctt
gcccaacagcagatgttaaaggaagaagatgaacaactgaagatactaagtggttttgcc
agtttgaaaggaaacctggaggggctttcctataacagtgccattgaaactctgggccag
tggaagcatcttaactgggcaacagtgaagaatgaacaagataatgtaaaagtgaagttt
gagcctcatactaatggtgagtgttttacacaagaggaacctctcagttctaacacatca
gttttgggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactcgagt
tcttgttctatgagccagagaatgaacacgtgtccaaacaggagagctgcatcattctac
aatagagaccaaaatttcttaaatttggcatcaacttgtccttcccactgggggagcgca
gaaaacggccagtcttactcggggctcccacagcgctgtgcagagagctatgtgacagac
catctgaagctgcagagaccattgatatcctcagagtctctctatgacacagccattccc
ttggagacgcccatcaaaacggagtacgactctgattctgaaaacattgccgataactac
ctgctttcgcagagccgagcctggccggatgagagcggctcggtgagaaagcagctgtcc
agctaccccagcagaatgcacctcaaaacagagccggacctctgcgagccagccttgcct
tgccagaagccaaggcactgcctttacacgccccacaactggcaatgcatcatagcaaat
catcccaacaacctgagcttgaacagagcgtgcaagggttcacggaacagggacgcgacc
tcgttttgcccccagaactcctctgtgtgtttggaaagcacgcccgacctgccacatatg
gcttgttacagccacttctacagccccagcccaggggaggagaaagagcaggttaatgag
gtgttcaaaatgccatgtgaatttaaaaacccctgcttggttcaagcaattaagcgtgag
cccctggattctccaccattgtccaacagcggacagaacagggcacacgtgagcttccct
gaaagtacattagcaggtcctgtgcctcataaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system