KEGG   Ficedula albicollis (collared flycatcher): 101815768Help
Entry
101815768         CDS       T02815                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04110  Cell cycle
fab04115  p53 signaling pathway
fab04218  Cellular senescence
fab05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fab00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101815768 (CDK6)
   04115 p53 signaling pathway
    101815768 (CDK6)
   04218 Cellular senescence
    101815768 (CDK6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101815768 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101815768 (CDK6)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101815768 (CDK6)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101815768 (CDK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like RIO1 FTA2 Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 101815768
NCBI-ProteinID: XP_005041155
UniProt: U3K755
Position
2
AA seq 326 aa AA seqDB search
MDKDSTNLADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMLQLFRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATAVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEE
EDWPNDVALPRNAFTSRPAQPIEKFVPDIDELGKDLLLKCLAFNPAKRISAYVALSHPYF
HDLEKFKENLDCHVSSSQNSSEVNAS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggataaggacagcacaaacctggctgaccagcagtatgaatgtgtggctgagattggg
gaaggagcctacgggaaggtgttcaaagcccgagacttgaagaacggaggtcgctttgtt
gcgctgaagcgggtgcgggtgcagaccagcgaggaggggatgccactgtccactatccga
gaggtggcagttttgaggcacctggagacattcgaacaccccaacgtggtcagattgttt
gatgtgtgcaccgtgtcacgaacagacagagagacaaagttaacattagtgtttgaacat
gtggatcaagacttgactacttacttggataaagttccagagcctggagtgcctactgaa
actataaaggatatgatgcttcagctgtttcggggactggattttctgcattcgcatcgt
gtggtgcatcgggatctgaaaccccaaaatatccttgtaaccagcaatgggcagataaaa
ctggctgactttggccttgcacgaatctacagttttcagatggctcttacctcagtggtt
gttactttgtggtatagagctcctgaagtcttgcttcagtccagttatgcaacagcagtt
gatctttggagtgttggctgcatatttgcagaaatgttccgtcgaaaaccactcttccgt
ggaaattcagatgttgatcaactaggaaaaatctttgatgtaattgggctcccagaagaa
gaggactggcctaatgacgttgcccttccaagaaatgcttttacttccagacccgcacaa
cctattgaaaaatttgtaccagatatcgatgaattaggcaaagacttgcttcttaaatgc
ttagcattcaacccagccaagagaatatctgcctatgttgccctctctcacccatatttc
catgatctggagaaattcaaggagaatctggactgtcacgtgtcatccagccaaaactcc
agtgaggtgaatgcatcataa

DBGET integrated database retrieval system