KEGG   Ficedula albicollis (collared flycatcher): 101815955
Entry
101815955         CDS       T02815                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fab03021]
    101815955 (AFF3)
Transcription machinery [BR:fab03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101815955 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 101815955
NCBI-ProteinID: XP_016161613
Position
1
AA seq 1125 aa
MDSFDLALLQEWDLDSLCVYEPDRNVLRRKEWERRNQEAQQDNGAFNTSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTSLPKADEHLIADSRPPP
PPPISSTTSATPAPLAAQQSKSTTMGWQKAGHSATSDGQQRAGKHGHRSLESHKGDFKLA
SQKSSLEKLKRYASSPTSSSSSSSSSSSSSSSSSSNSAQQSSLRATLGDNISRVQQPAKL
SCSSEGGTQVQERPAKHGGGHCVQNFPPSLASKPSLGQQKPTAYVRPMDGLDQAPDESPK
LKLPAETTKSYRGVPSSKPDSARTKSKITKFSIPKQEEDSGTGDNSCIEEILREMTHSWP
PPLSAIHTPGKAEQSKFPFPNKESQQGSTGHSNTRKSDVEPKSPEKSATHSSMLEDDLKL
SSDEEENDQQAAQRSALRVLSDSLVVPQPNARASGLSSKGSSSSSSSESETSSESDSESE
SSSSESDGSKPSHYSSPEPEPPSSNKWQLDKWLNKVTPHKAPILSHHDGPALEAHPYYGR
AKVERQEGQKAPAEAPAEHRRHRREPRSAAAGEKRRARGPSKTAPKSKEFIETESSSSSS
SSDSGSESEREERPLPKAPAAASAFGSINARTSSEIAKELEEQFYTLVPFGRNELLSPLK
DSDEVKSLWVNIDLALLSRIPERLPEEPLAMSAGANQAASFPQGSSAEPPAEKGLPKSRR
KRKCENEEECRDIKKTHLERESSSRLAASAPSITTANHCNMNENSLAIPINKNEKMLRSP
VSPLSDASKHKYSNDDLTSSSRPNGSSLLPSISSSKKHKGEIQSQPHPGDFNKAIHINSE
NVLLCNKPQFQTEPWSPLSTTPRDCRRTKLVFDDIPRNADYFMQEAKRKKHKADAMVEKF
GKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDK
QLAALCYRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKAAQNPSPWGASGKSTGTPS
PMSPSPSPVSSVGSQGSTGAPSPSPIITIPQRIHQMAANHVSITNSILHSYDYWEMADNL
AKENRDFFNDLDALMGPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3378 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagctctccttcaggagtgggacctggactctctgtgtgtgtat
gagccagacagaaacgtgctgcggaggaaagaatgggagaggagaaatcaggaggcccag
caggacaatggcgcgtttaacacgagctattccctcttcagtgaaccatacaagactaac
aagggggatgagctttccaatcgcatccagaacacgttgggcaactatgatgaaatgaaa
gacttgttgacggaccggtccaaccagagccatctcgttggggtcccgaaacctggggtt
cctcagacatccctccccaaggctgatgagcatctcatcgcagactcgagaccaccacct
cctcctcctatttccagcaccacttctgccacaccagcacccctagctgcgcagcagagc
aaaagtaccaccatgggctggcagaaggctgggcacagtgccacttcagatggccagcag
agagcgggcaagcacggacaccggtcgctggagtcacacaagggtgacttcaaactggcc
agccaaaaatccagtttggagaaactaaaacgctatgcatcgagtcccacctcctcctcc
tcctcttcctcctcctcctcttcttcctcctcctcctcctcctccaatagtgcccagcaa
agctcgctgcgagccacattaggagacaacatcagtagagtccagcagccagcgaagctc
agttgtagctcagaaggaggaactcaagtccaagagaggccagcaaagcatggtggggga
cactgtgtccaaaacttcccaccctctcttgcttcaaagcccagtctgggtcagcagaag
ccaacagcttatgtaaggccgatggacggtctagaccaggctcctgatgagtctccaaag
ctgaagttaccagcagagacgaccaagtcctatcggggagtgccttccagcaagcctgat
tcggccaggaccaagtcaaagatcaccaagttcagcattcctaagcaagaagaagacagt
ggaacaggagataacagctgcattgaagaaatattgcgggagatgacccattcatggcct
ccaccactgtcagctattcacacaccaggaaaggcagaacaaagcaagtttcccttccca
aacaaggagtcacagcagggatctacaggacacagcaatacaaggaaaagtgatgtagag
ccaaagagcccagagaaaagcgccacccattcatcaatgctagaagatgacctcaagtta
agcagtgatgaagaggagaatgaccagcaggcagcacagagatctgctctccgcgttcta
tctgacagcctggtggtgccgcagcccaatgcccgagcctcgggactctccagcaagggg
tcgagcagcagcagctccagtgaatccgagaccagctcagagtctgactcagagagcgaa
agcagctccagtgagagcgacggcagcaagccctcgcattactccagcccagagcctgag
ccgccctcgtccaacaagtggcagctggacaagtggctgaacaaagtcacccctcacaaa
gcacccatcctaagccaccacgatggcccggcgctggaagcccatccctactacggccgc
gcgaaggtagagcggcaggaaggacagaaggccccggctgaggccccggccgagcaccgc
aggcaccgccgggagccccgctcggccgcagctggtgagaagcgccgggcccgagggccg
agcaaaacggcgcccaaatccaaggagttcatcgagaccgagtcttcatcctcatcgtcc
tcctccgactcaggctctgagtcggagcgggaggagcgcccgctgcccaaggcgccagcg
gcagccagtgcctttggctctattaatgccaggactagtagtgaaatagcaaaggagctg
gaggaacagttttacaccctggttcctttcggtaggaatgagctcctgtctcctctgaaa
gacagtgatgaggtaaagtcgctgtgggtcaacattgacttggctcttttgtccaggatt
ccagagcgtttgcccgaagaaccgctggccatgagcgccggagcaaaccaggcggccagc
ttcccgcagggtagtagtgctgaaccccccgcagagaagggtttaccgaaatctagaagg
aaacgcaagtgcgagaatgaggaagagtgcagagacatcaagaagactcacttagagcga
gagagttcttcacgattagctgcctctgccccaagtatcacaacagcaaatcactgcaat
atgaatgaaaatagcttggcaataccaataaataaaaatgagaaaatgcttcggtcaccc
gtctctcctctctctgatgcatcaaaacacaaatattccaacgatgatttaacttcctcc
agcagacctaatggcagcagtctattaccttcaatctcctccagcaaaaaacataagggt
gaaatccagtcacagccacatcctggagacttcaataaagcaattcacatcaattcagaa
aatgttcttctctgcaataagccacagttccaaacagagccttggtcacctctgtccacc
acacccagggactgcagaagaacaaagcttgtcttcgatgatataccacgcaatgcagat
tactttatgcaggaagctaaacggaagaagcataaagcagatgcaatggtggagaagttt
ggaaaggcactgaattatgcagaagcagcactatcatttattgagtgtggaaatgcaatg
gaacaaggcccaatggaatctaaatccccttataccatgtattcagaaacagttgaactc
atcaggtatgcaatgagactaaaaacccactcaggccccaatgccacgccagaagacaaa
cagctggcagcattatgttaccgctgcctggcccttctgtactggaggatgttccgactc
aagagagaccacgcagtcaagtattcaaaagcacttattgagtatttcaagaattcctca
aaagctgcccaaaacccatctccttggggtgccagtggaaagagcacaggaactccatca
cctatgtcccctagcccttctccagtcagttctgtaggatcccaggggagcacgggggct
ccttccccatctcctatcatcaccatcccgcagcgcattcatcagatggctgccaaccac
gtcagcatcaccaacagcatcctgcacagctatgactactgggagatggctgacaacctg
gccaaggaaaacagagatttttttaacgacttggacgcattgatgggacctatcaccttg
cacagcagtatggagcatttggttcaatacactcaacaaggacttcactgggtgcggaat
agcgctcacttgtcataa

DBGET integrated database retrieval system