KEGG   Ficedula albicollis (collared flycatcher): 101816105Help
Entry
101816105         CDS       T02815                                 

Gene name
PARP11
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 11
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101816105 (PARP11)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101816105 (PARP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE
Motif
Other DBs
NCBI-GeneID: 101816105
NCBI-ProteinID: XP_005061529
Position
1
AA seq 341 aa AA seqDB search
MPELGLGLEKEMLQGPSEDVFAKMENSVEDMDTSDTQWGWFYLAECGKWHMFQTDSNSHC
SISSEDIERSFRTDPHGSLSFTTAKFNYTLDFSVMKQINLTTLKQRPIKRAPFAINSFSF
ICENEAIPMPSHWENVNTEEPYQLIPLQKKTNEYNEVSSLFGKTMDSHRIKRIKRIQNLD
LWEFFCRKKAQLKKKRGVPTINEQMLFHGTSNEFVEAICIHNFDWRINGMHAAVYGKGTY
FARDASYSSHFCKESMKHGDTFQIHGVNLQPHLHRPDKVMFLARVLTGDYIGGDSKYMRP
PSKDGSFVNLYDSCVDNTWNPKIFVIFDANQIYPEYLIEFC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactgggactgggcctggaaaaggaaatgcttcaaggaccatcagaagatgtg
tttgcaaagatggaaaattcagttgaagacatggatacctctgatacccagtggggctgg
ttttatttggctgagtgtggtaaatggcatatgtttcagactgactcaaacagtcactgc
tctattagcagcgaagatattgaaaggagtttccgaacagaccctcatggatctctttct
tttaccactgcaaagtttaactacacactggacttttcagtgatgaagcaaatcaaccta
actaccctcaaacaacgtccaataaagcgagctccctttgcaatcaattcattcagtttc
atctgtgaaaatgaggctatccctatgccttcacactgggagaatgtaaatacggaggag
ccgtaccagcttattccattgcaaaagaaaacaaatgaatataatgaagtttctagtctc
tttggaaaaacaatggatagccaccgaattaaaagaattaagagaatacaaaatctagac
ttgtgggagtttttttgcaggaaaaaagctcaactgaagaagaaaagaggtgtcccaacg
attaatgagcagatgctgtttcatggcacaagtaatgaatttgtagaagcaatatgtatt
cataattttgactggagaataaatgggatgcatgctgctgtgtatggaaaagggacctat
tttgcaagagatgcatcatattccagccatttctgcaaagagagcatgaagcatggagat
actttccagattcatggtgtgaacctgcagcctcatctgcatagaccagataaagtcatg
tttcttgctcgtgtattaactggtgactatatcggcggcgattcaaaatacatgaggcct
ccttcaaaagatgggagctttgtgaacttgtatgacagctgtgtggataacacctggaac
ccaaagatctttgtcatctttgatgccaaccaaatctaccctgagtacttaatagaattt
tgttaa

DBGET integrated database retrieval system