KEGG   Ficedula albicollis (collared flycatcher): 101816877Help
Entry
101816877         CDS       T02815                                 

Gene name
IRAK4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04010  MAPK signaling pathway
fab04620  Toll-like receptor signaling pathway
fab04621  NOD-like receptor signaling pathway
fab05164  Influenza A
fab05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101816877 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101816877 (IRAK4)
   04621 NOD-like receptor signaling pathway
    101816877 (IRAK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101816877 (IRAK4)
   05168 Herpes simplex virus 1 infection
    101816877 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101816877 (IRAK4)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101816877 (IRAK4)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: TKL group
  IRAK family
   101816877 (IRAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Death
Motif
Other DBs
NCBI-GeneID: 101816877
NCBI-ProteinID: XP_005039420
UniProt: U3K6I3
Position
1A
AA seq 464 aa AA seqDB search
MGEPVTDSTYVRCLSYGLVRRLAEFIDPQEGWKKLAVDITNPSGESRYSQVHIRRFEAFV
QMGKSPTCELLFDWGTTNCTVADLVDLLIRNQFLAPASLLLPEAVRMPQEVTLPLSSQET
LPIHEKQLPVQEKEVASVKPFLSQGTEKQYSEPYCSSEENSHSQSSNTDFQNFLFHDLES
ITNNFDARPESAGGNKLGEGGFGIVFKGYINGKNVAVKKLIAMVDVSVQDLKQQFEQEIN
IMAKCQHENLVELLGFSSDGAQPCLVYEYMPNGSLLDRLACLDETPPIPWNMRCKIVQGT
ANGINFLHENNHIHRDIKSANILLTDTYVPKISDFGLARASVTFTQTIMTERIVGTAAYM
APEALRGEITPKSDIFSFGVVLLEIITGLPPVDENREPQLLLSIKDEIEDEEATIEDYVD
EKMNDWDVPSIHKMYSIAERCLNDKKTRRPDIKMVQQQLQEIKT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcccgtgacggattccacgtacgtccgctgcctgagctacgggctcgtgagg
cggctggcggagttcatcgacccgcaggaagggtggaagaaacttgcggtggatataacc
aacccgtccggtgaaagcagatacagccaagtgcatataaggagatttgaggcatttgtg
caaatgggaaagagccccacatgtgaattactttttgactggggaaccacaaactgtaca
gtggctgatcttgtggatcttctgattaggaatcagttcctagcaccagcaagccttttg
cttccagaagctgtaaggatgccacaagaagttacattacctctttcttcacaggaaacc
ttgcctatacatgaaaaacaactacctgtacaggaaaaagaagtggcatctgtaaagcct
tttttatctcagggtactgagaagcagtattcagaaccttactgctcaagtgaagaaaac
agccactcacagtccagtaacacagatttccaaaattttttgtttcatgacttggaaagc
attacaaataattttgatgccagaccagaatcagctggaggtaataaactgggagaaggt
ggctttggcattgtgttcaaaggctacatcaatggcaaaaatgtggctgtcaagaagctc
attgctatggttgatgttagtgttcaggacctgaaacagcagtttgagcaagaaataaac
ataatggcaaagtgtcagcatgaaaatttagtagaattacttggtttctcaagtgatggt
gctcagccatgtctggtgtatgaatacatgcccaatggctcactgcttgacagacttgct
tgtctggatgaaactccaccaattccttggaatatgaggtgtaaaattgttcaaggtaca
gcaaatggcatcaactttttgcatgaaaataatcatattcacagagatatcaaaagtgca
aatatcttattaactgatacatatgtacccaaaatttctgactttggccttgcaagagca
tctgtaacattcacacagacaatcatgactgaaagaattgttggaacagcagcctatatg
gcacctgaagctctgcgaggagagataacacctaaatctgatatcttcagttttggagta
gtcttactagaaataataacgggtcttcctccagtagatgaaaaccgggagccacagttg
ctgttaagtataaaagatgaaattgaggatgaggaagcaactattgaggactatgttgat
gaaaagatgaatgactgggatgtaccttcaattcataaaatgtattcaattgctgagcgc
tgtctgaatgacaaaaagaccagaaggccagacattaagatggtccaacagcagctccaa
gagataaaaacttga

DBGET integrated database retrieval system