KEGG   Ficedula albicollis (collared flycatcher): 101817314Help
Entry
101817314         CDS       T02815                                 

Gene name
ASB13
Definition
(RefSeq) ankyrin repeat and SOCS box containing 13
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fab04121]
    101817314 (ASB13)
Ubiquitin system [BR:fab04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101817314 (ASB13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank Ank_2 Ank_4 Ank_3 Ank_5 SOCS_box
Motif
Other DBs
NCBI-GeneID: 101817314
NCBI-ProteinID: XP_005039053
UniProt: U3KAY9
Position
1A
AA seq 268 aa AA seqDB search
MLSKGFWADRTPVHEAARSGEIVQLRQLIESGACVNAVTYDSITPLHEASLRGQAQCVKL
LLDAGAQVDARNIDGSTPLCDACASGSIECVKVLLSHGAKVNPPLYTASPLHEACMNGSS
ECVQLLIDVGANLEAHDCHFGTPLHVACAREHLDCAKLLLQAGANVNAAKLHETALHHAA
KVRNAALVELLVQFGGNIYARDNRGKKPSDYSWSSSATARCLEYYEKTPLSLAQLCRLSV
RRAAGHRGLDKISRLQIPPRLIQYLSYN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcaaaggtttctgggctgacaggacaccagtgcacgaggctgccaggagcggg
gagatcgtgcagctgcggcagctgatcgagagcggcgcctgcgtcaacgccgtcacctac
gactccatcacccccctgcacgaggccagcctcaggggacaggcccagtgtgtcaaactc
ctgctggatgcaggggctcaggtggacgccaggaacatcgacggcagcactccgctgtgc
gacgcctgcgcctcgggcagcatcgagtgcgtcaaggtgctgctgtcccacggagccaag
gtcaacccgcccctctacaccgcctcccctctgcacgaagcctgcatgaacggcagctca
gagtgtgtgcagctgctcatcgacgtgggtgccaacctggaggctcatgattgtcacttt
gggacccccctgcacgtggcctgtgccagggaacacctggattgtgccaagctgctcctc
caggcaggagccaacgtgaacgcggccaagctgcacgagacggcgctgcaccacgcggcc
aaggtgcgcaacgcggcgctggtggagctgctggtgcagttcgggggcaacatctacgcg
cgggacaaccgcggcaagaaaccctcggactacagctggagcagcagcgccaccgcgcgg
tgcctggagtactacgagaagaccccgctgagcctggcgcagctgtgccgcctctcggtg
cgcagagctgccgggcaccgcggcctggacaagatctcccggctgcagatccccccccga
ctcatccagtacctgtcctacaactga

DBGET integrated database retrieval system