KEGG   Ficedula albicollis (collared flycatcher): 101818854Help
Entry
101818854         CDS       T02815                                 

Gene name
TYW3
Definition
(RefSeq) tRNA-yW synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fab03016]
    101818854 (TYW3)
Enzymes [BR:fab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     101818854 (TYW3)
Transfer RNA biogenesis [BR:fab03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    101818854 (TYW3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 RRXRR Staygreen
Motif
Other DBs
NCBI-GeneID: 101818854
NCBI-ProteinID: XP_005050760
Position
8
AA seq 225 aa AA seqDB search
MGSPSKGPLFIPGAGSAHRAIVTVCVHRQDTDGSGIQKKNCTWLLVTHEPCAKDDVMTAL
EKATGDAVFKFEPFVLHVLCRELQDAQLLHSVAIDSGFRNSGITVGRGGKITMAVRSTHC
LEVPLSHKGRLMVSEEYIEFLVHVANQKMEENMRRIDRFHKGLELALEAAVPADTLFPEV
PQKSHSVYLHRRKRRAAQGQADPSRELEPQDDTESSLALFAEIMI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggctcaccctccaaggggccgctctttattcccggggccggctctgcacacagagcc
attgtaacggtttgtgtccatcgccaggacacggacggctcgggcatccagaagaagaac
tgcacgtggctgctggtgacgcatgagccgtgtgccaaggacgatgtgatgacagcacta
gagaaagccactggtgatgctgtgttcaagtttgaaccatttgttcttcacgtgctgtgt
cgggagctgcaggatgcacagctgctgcattcggtggctattgactctgggttcaggaac
tctggtattacagttggcagaggaggaaaaattacaatggctgtgcggagcactcactgc
ttggaagttccattgagccacaaagggagattgatggtttctgaagaatatattgaattt
ctggtacatgtggccaatcagaaaatggaagaaaacatgaggaggattgacaggttccac
aaaggcctggagctggctctggaggctgctgtccctgcagacaccttgtttcccgaggtg
ccacagaagagccactctgtgtacctgcacaggagaaagagacgggctgctcaggggcag
gctgatcccagcagagagctggagccccaggatgacactgagagcagccttgctctgttt
gctgaaatcatgatatag

DBGET integrated database retrieval system