KEGG   Ficedula albicollis (collared flycatcher): 101819345Help
Entry
101819345         CDS       T02815                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab04270  Vascular smooth muscle contraction
fab04350  TGF-beta signaling pathway
fab04510  Focal adhesion
fab04530  Tight junction
fab04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101819345 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101819345 (ROCK1)
   04530 Tight junction
    101819345 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101819345 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101819345 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101819345 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fab03036]
    101819345 (ROCK1)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101819345 (ROCK1)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   101819345 (ROCK1)
Chromosome and associated proteins [BR:fab03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101819345 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH Cortex-I_coil Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 101819345
NCBI-ProteinID: XP_005041993
Position
2
AA seq 1358 aa AA seqDB search
MSTGESFESRFEKIDVTLKDPKSEVNVDCLLDGLDALVYDLDFPALRKNKNIDNFLNRYK
DTVNKMRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRRVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDSDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLGVPAENSNDNRTAS
SVDKSVLENMQKMIYELEEQLHNEMQLKDEMEQKCRSSNIKLDKIMKELDEEGNQRKNLE
TTVSQIEKEKMVLQHKINEYQRKFEQENEKRRNAENEVSTLKDQMEDLKKISQHSQISNE
KITQLQKQLEEANDLLRTESDTAARLRKGNTEMSKSLSQVESLNRELQERCRVLESTKLQ
VEKDYYQLQAALESERRDRSHGSEMIGELQVRITTLQEEVKNIKNNLERVEAERKQAQDM
LNHSEKEKNNLEIDLNYKLKSLQDRLEQEVNEHKVTKARLTDKHQSIEEARSVAMCEMEK
KIKEERAAREKAENRIVQAEKQCSMLDFDLKQSQQKLEHLLQQKERLEDEVRNLTLKLEQ
ETNKRIIAQNELKAQAFEADNLKGSEKQLKQEINTLLEAKRLLEFELAQLAKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIDERNKETQRKMQELQNEKETLATQLDLAETK
AESERLARALAEEQYYELNQESKKAASRHRQELTDKDIIIRRLEETNNTLTKDVDLITKE
NTEISEKFKKQEEDYKMKKEEEINNIRMHYEKSINTEKTLKTQAVNKLAEIMNRKDFKID
RKKANMQDLRKKEKENRKLQLELNQEKEKFNQMVVKYQKELNEMQAQLAEESTYRNELQM
QLDSKESDIEQLRRKIMDLQQGMDSTSVASLPTDEMDGNLPESRLEGWLSVPNKGNIRRH
GWKKQYVVVSSKKILFYNDEKDKDQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEVEPVQPAEKTNFLNHKGHEFIPTLYHFPANCEACAKPLWHVFKPP
PALECRRCHVKCHRDHLDKKEELIAPCKVSYDVTSARDLLLLASCQDEQKKWVTHLVKKI
PKTPPSTFVRASPRTLSTRSSANQSFRKVVKNTSGKTS
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgggagaaagttttgagtctcggtttgagaaaatcgacgtgactttgaaggac
cccaaatccgaagtgaacgtggactgtttgctggatggattagatgctttggtatatgac
ttggattttcctgccttaagaaaaaacaagaacattgataacttcttaaacaggtataaa
gacacagtaaataaaatgagagatctgcgcatgaaagctgaagattatgaagtggtgaag
gtgatcggtagaggggcatttggggaggttcagttggtaaggcataaatcctcaaggaga
gtgtatgctatgaaacttctgagcaaatttgagatgataaaaagatctgattctgcattc
ttctgggaagaaagggatattatggcttttgctaatagtccctgggttgttcagttattt
tatgcattccaagatgaccgttacctttacatggtgatggagtacatgcctggtggggac
cttgtgaatttaatgagtaactacgatgttccagagaaatgggcaagattttatactgct
gaagttgtacttgcattagatgcaattcactcaatgggttttatacacagagatgtgaag
cctgataatatgctgctagataaagccggtcatttaaaattagcagattttggtacttgt
atgaagatgaacaaggaaggaatggtacgatgtgacacggctgtgggaacaccagactac
atctctcctgaagtattgaagtcccaaggaggggatggttactatgggcgggaatgtgac
tggtggtcagttggagtcttcttgtatgagatgcttgtaggcgatacacctttttatgca
gattctttggttggaacgtacagtaagattatgaaccataagaactcccttactttccct
gatgacagtgacatttctaaagaggcgaaaaacctcatttgtgcctttttaactgatagg
gaagtgaggctaggacgaaatggtgtagaagaaattaaacgacaccttttcttcaaaaat
gatcagtgggcttgggaaacacttagagacactgtagcaccagttgtgcctgacttaagt
agtgacattgacactagtaattttgatgatctggaagaagacaaaggagaggaagaaaca
tttcccattccaaaagcatttgtgggcaaccagcttccttttgtaggatttacatactac
agcaatcgtcggtatttaggtgtccctgcagaaaattcaaatgacaacagaacagcctcc
agtgtggacaaaagtgtgctggaaaatatgcagaagatgatctatgagttagaagaacag
ctacataatgagatgcagttgaaagatgaaatggagcaaaagtgcagatcttcaaatata
aagctagacaagataatgaaggaactggatgaagagggaaatcagaggaagaacttggaa
acaacagtgtctcagattgagaaggaaaagatggtattacaacataagataaacgagtac
caaagaaaatttgaacaagagaatgagaaaagacgtaatgcggaaaatgaagtgtccact
ctaaaagatcagatggaagacttgaaaaaaatcagccagcattcacaaatttcaaatgag
aagataacacagttacaaaaacaactagaagaagcaaatgatttgctgaggacagaatct
gacacagctgcaagactgagaaagggtaacacagaaatgagcaagtcattaagtcaagta
gaatcactgaatagagaactgcaggaaaggtgcagagttctggaaagcacaaaactgcag
gtggagaaagattattaccaactacaagcagctttggagtcagaacgaagggacagaagt
catggatctgaaatgattggagaactacaggttcggattacaactttacaagaagaagta
aaaaacattaaaaacaatcttgaaagagtggaagcggaaagaaaacaagcacaggatatg
cttaatcattcagaaaaggagaagaataatttagagatagatttgaactacaagctgaaa
tccttacaagaccggttagaacaggaagtcaatgagcacaaagtgactaaggcgcggtta
actgacaaacaccagtcaatagaggaggcaagatcagttgccatgtgtgaaatggaaaaa
aagataaaggaggaacgggcagcaagagaaaaggcagaaaatcgaatagttcaagctgaa
aaacagtgttccatgttggactttgacctgaagcaatctcagcagaaactggaacatctt
cttcagcaaaaggagagactggaagatgaagtaaggaatctgacacttaagctagaacaa
gagacgaataagcgaataatagcacagaatgaattaaaggcacaagctttcgaagctgat
aacttgaagggttctgagaagcagctgaaacaggaaatcaataccttgttggaagcaaag
agattactggaatttgagttggctcaacttgcaaaacagtacagaggaaatgaaggtcag
atgcgtgagcttcaggatcagcttgaagctgagcagtatttttcgacactttacaaaact
caggttaaggaactgaaagaggaaattgatgaaaggaataaagaaacgcaaagaaaaatg
caggagttgcaaaatgaaaaagaaacacttgccacccagttggatttagctgaaaccaaa
gctgagtcggaacgattggcacgggcacttgctgaagaacagtattatgaactgaatcag
gaaagcaaaaaagctgcatcaaggcacagacaagaattgactgataaggacatcatcata
agaaggctggaagaaactaataacactttaaccaaagatgttgatttaataacaaaggaa
aacacagagatcagtgaaaaatttaagaaacaagaggaagattacaaaatgaaaaaagag
gaagaaatcaataatattagaatgcattatgagaagagcataaacactgaaaaaactttg
aagacacaggcagtcaacaaactggctgagataatgaatcgaaaagattttaaaatagac
agaaagaaagctaacatgcaagatttgaggaagaaggagaaggaaaaccgaaagctccaa
ttagaacttaatcaagaaaaagaaaaatttaatcagatggtagtgaaataccaaaaggag
cttaatgaaatgcaagcgcaactagcagaagaatctacatacaggaatgagctccagatg
cagctggatagtaaagagagtgacatagaacaactacgaaggaaaatcatggacctccag
caaggaatggattctaccagtgttgccagtcttccgacagatgaaatggatggaaatctt
ccagaatcaagacttgaaggttggctttcagtaccaaacaaaggaaatataaggcggcat
ggctggaaaaaacagtatgttgtggtgagcagtaaaaagatactgttctacaatgatgaa
aaagacaaggaccagtctaatccatctatggtactagatatagataagctgtttcatgtc
cgacctgtaactcaaggagatgtatatagagctgaaactgaagaaattcctaaaatattc
cagattctctatgctaatgagggggaatgcaggaaggatttggaggtagaaccagtacag
ccggcagagaagacaaattttctaaatcacaaaggccatgaatttattcccacgttatac
cactttccagccaactgtgaggcctgtgccaaacctctctggcatgtctttaaaccccct
cctgccctagaatgtcgaagatgccatgtgaagtgccacagagaccacttggataaaaag
gaggaattaattgcaccatgcaaagtgagttacgatgtaacttcagcaagagacttgctc
ttgttggcatcctgtcaagatgaacagaagaagtgggtgacacatttagtaaagaagatc
cctaagacaccaccatctacttttgttcgtgcttctcctagaactttgtctacaagatcc
tcagcaaaccagtcattccgaaaagttgttaaaaatacttctggaaaaactagctaa

DBGET integrated database retrieval system