KEGG   Ficedula albicollis (collared flycatcher): 101820047Help
Entry
101820047         CDS       T02815                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fab01002]
    101820047 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fab03110]
    101820047 (TPP2)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     101820047 (TPP2)
Peptidases and inhibitors [BR:fab01002]
 Serine peptidases
  Family S8: subtilisin family
   101820047 (TPP2)
Chaperones and folding catalysts [BR:fab03110]
 Intramolecular chaperones
  Subtilisin family
   101820047 (TPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 101820047
NCBI-ProteinID: XP_005037812
Position
1
AA seq 1235 aa AA seqDB search
MPKSSSWQQEPPYRLLALNYSEPVWIAAITTDGKPKIIDIIDTTGSGDVTTCTIAEPKDG
EISGLSGRTLKIPANWVNPSGKYHIGIKNGYDIYPKALKERIQKERKEKLWDPVHRLALA
EACRKQEEFDAAHSSPSQVNKLIKEELQNQVELLNSFEKKYSDPGPVYDCVVWYDGETWR
ACIDTSESGDLANCTVLRTYKEAQEYGSFGTSEMLNYSVNIYDDGNLLSIVTSGGAHGTH
VASIAAGYFPEEPERNGVAPGAQILAIKIGDTRLSTMETGTGLIRAMIETIKYKCDLVNY
SYGEATHWPNSGRICEVINEAVWKHNVIYVSSAGNNGPCLSTVGCPGGTTSSVIGVGAYV
SPDMMVAEYSLREKLPANQYTWSSRGPSTDGALGVSISAPGGAIASVPNWTLRGTQLMNG
TSMSSPNACGGIALVLSGLKANNVHYTVHSVRRALENTAVKAENIEVFAQGHGIIQVDKA
YDYLIQNSSFTSNIGFTVTVGSNRGIYLRDPAQIVAPSDHGVGIEPVFPENTENTERISL
QLHLALTSNASWVQCPSHLELMNQCRHINIRVDPRGLREGVHYTEVCGYDTAMPNAGPLF
RVPITVVMPTRVDESSSYDLTYTDVHFKPGQIQRHFIDVPQGATWAEVTVCSCSADVTAK
FVLHAVQLVKQKAYRSHEFYKFSSLPEKGSVTEAFPVLAGKTLEFCVARWWASLSDVSIN
YTISFHGVLCGAPQLNMHASEGIVRFDVQSLLKYEDIAPCINLKSWVQTLRPVSAKIKPL
GSRDILPNNRQLYEMILTYNFHQPKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQM
GSGDAYPHQYSVKLEKGDYTIRLQIRHEQNSELDRIKDLPFIVSHRLSSTLSLDIYENHS
LALLGKKKSNSLTLPPKHSQPFFVTSLPDDKIPKGAGPGCYLAGSLTLSKTELGKKAGQS
AAKRQGKFKKDVLTVHYHLIPSPSKSKNGSKEKEKEQEKEKDAKEEFAEALRDLKIQWMT
KLDTTDMYSELKEAFPNHLPLYVARLHQLDSEKERMKRLDEIVEAANTVISHIDQTALAV
YFAMKTDPRPDATTIKNEMEKQKSTLVDALCRKGSALADQLLHLQTQEGAASSDAEGKDE
DHESCSEALTETFWETTKWTDLFDSKVLTFAYKHALVNKMYGRGLKFATKLAEEKPTKDN
LKNCIQLMKLLGWTHCATFTANWLPVMYPPDYCVF
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagagcagttcatggcagcaggagccgccgtatcggttacttgcactaaattac
agtgaacctgtctggattgctgctattacaactgatgggaaaccgaagataattgatata
attgacactacgggcagtggtgatgtaactacttgtaccattgcagaacctaaagatgga
gaaatttctggtctttctggaagaactttaaagattccagcaaactgggtaaatccttca
ggcaaatatcacattggcataaaaaatggttatgatatctatcctaaagctcttaaggag
aggattcagaaagagcgcaaggaaaagctctgggatcctgttcacaggctggctctagca
gaggcctgtaggaaacaagaagaatttgatgctgctcatagctctccctcacaggtaaat
aagctaataaaggaggaacttcaaaatcaagtggaattattgaattcttttgagaaaaaa
tacagtgatcctggcccagtatatgattgtgtagtgtggtatgatggtgagacctggaga
gcctgcatagatacaagtgagagtggtgacttagctaactgtacagtgctgagaacctac
aaagaggctcaggaatatggatcttttggaacatctgagatgttgaattattctgtgaat
atatatgatgatggaaacctcctttccattgtgacaagtggaggagcacatggaacacat
gtggctagtattgcagctggatactttccagaggaaccagaaaggaatggtgtggctcct
ggagctcagattcttgcaatcaagattggtgatacgagactaagtacaatggaaactggc
actggtctaataagagctatgatagaaacaataaaatacaaatgtgatcttgtcaactac
agctatggagaagcaacacactggccaaattctgggagaatttgtgaagtgattaatgaa
gcagtgtggaaacacaatgtaatctatgtttcaagtgctggaaataatggtccttgcctt
tctacagttggatgtcctggtggaactacatctagtgtaataggtgttggtgcctacgtg
tcacctgacatgatggttgctgaatactctttgagagaaaaactgccagcaaatcaatac
acttggtcatccagagggcctagcactgatggagcccttggagtaagtatcagtgcccca
ggaggtgctattgcttctgttccaaactggactctgcggggaacacaactcatgaacggc
acgtccatgtcttctcccaatgcctgtggaggcattgcgctggtattgtcaggactcaaa
gctaataatgttcattacactgttcattctgtcagaagagctttagaaaatacagcagtg
aaagctgaaaacatagaagtatttgcacaaggccatggcattattcaggttgataaagcc
tatgactacctcattcagaattcatcattcacaagtaacatcggcttcacagttactgtt
ggcagcaaccgtggaatctacctcagagatccagcccagatagtggcaccatctgatcat
ggggttggcatagaacctgtctttcctgagaatacagaaaatactgaaagaatatctctc
cagcttcatttagctttaacttcaaatgcatcatgggtccagtgtcctagtcatttagaa
ctcatgaaccagtgtcgacacataaatattcgtgtggatccacgtggcctgagagaagga
gtacattatacagaggtgtgtggatatgatacagcaatgcctaatgcaggtcctctgttc
agagttccaatcactgttgttatgccaacaagagtagatgaatcatcaagctatgacctg
acatacacagatgttcattttaaacctggtcagatccaaaggcacttcattgatgttcca
cagggagctacgtgggctgaagtgacagtgtgttcatgttcagctgatgtgactgccaag
tttgttcttcatgccgttcagcttgtgaaacaaaaagcatacagaagtcatgagttctac
aagttttcatccttaccagaaaaaggctcagtgactgaagcatttcctgtcttagctgga
aaaacccttgaattttgtgttgctcggtggtgggcaagccttagcgatgttagtattaat
tacacaatttctttccatggtgtactttgtggtgctcctcagctaaacatgcacgcttca
gaaggcatcgtgcggtttgatgttcagtccttgttgaaatacgaagatattgctccatgc
ataaatctgaaaagctgggttcaaacactcagaccagtgagtgcaaaaataaaacctttg
ggctccagagatattttaccaaataatcgtcaactgtatgagatgattttgacctataac
ttccatcagcctaagagtggagaagtaactccaagctgtccacttctttgtgaattgttg
tatgaatctgaatttgacagtcaactctggattatttttgaccagaacaaaagacagatg
ggttcaggagatgcctatccacaccagtattctgtgaaactggaaaaaggagattacact
attcggttacaaattcgacatgagcagaacagtgagctggatcgcatcaaagacctgcca
tttattgtttctcataggttgtctagtaccttgagcttagatatttatgaaaaccatagc
cttgctctcttagggaagaagaaatccaacagtttgacattaccaccaaaacacagtcag
ccattctttgttacatctctgcctgatgacaaaatacctaaaggagcaggaccaggatgt
tatcttgcaggaagtcttactttgtctaaaacagaacttggaaagaaagctgggcagtct
gcagcaaagcgacaaggaaaatttaaaaaggatgtccttactgttcattatcatctgata
ccatcaccatcaaagagtaaaaatggcagcaaagagaaagaaaaagaacaggaaaaagaa
aaagatgcaaaagaagaatttgctgaagctttaagagacctaaaaatacagtggatgacc
aagctggataccactgacatgtatagtgagttgaaagaagcatttcctaatcatcttcct
ctgtatgttgcaagacttcatcagctggattctgaaaaggaacgaatgaaaagacttgat
gaaattgttgaagctgcaaatacagtaatctctcatattgatcaaacagcattagcagta
tattttgccatgaagactgatcccaggcctgatgcaactactataaaaaatgaaatggaa
aaacagaagagtactttagtggatgcactttgtcgaaagggaagtgcactggctgaccag
cttcttcatctacagacccaagaaggggctgcttccagtgatgcagaaggcaaagatgag
gatcatgagagctgctcagaagctttgacagagacattctgggaaacaacaaaatggact
gatctttttgacagcaaggttttgacttttgcctataagcatgcattggtaaataaaatg
tatggaagaggtctcaagtttgccacaaaacttgcagaagagaagccaacaaaggacaac
ttaaaaaactgcattcagctaatgaagctgcttggatggactcattgtgcaactttcact
gcaaattggcttcctgtcatgtatccacctgattattgtgtattctag

DBGET integrated database retrieval system