KEGG   Ficedula albicollis (collared flycatcher): 101820215Help
Entry
101820215         CDS       T02815                                 

Gene name
CDKL2
Definition
(RefSeq) cyclin dependent kinase like 2
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fab01001]
    101820215 (CDKL2)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101820215 (CDKL2)
Protein kinases [BR:fab01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   101820215 (CDKL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase RIO1 APH MdcG
Motif
Other DBs
NCBI-GeneID: 101820215
NCBI-ProteinID: XP_005044605
UniProt: U3JDY6
Position
4
AA seq 552 aa AA seqDB search
MAMDKYQVLGLVGEGSYGVVTKCRNRESGRIVAVKKFLESDDDAAVRKIALREIKLLKQL
RHENLVNLLDVCKRKKRWYLVFEFVDHTVLDDLEASPNGLDYDRVRKYLFQIIRGLAFCH
SHNIIHRDIKPENLLVSQSGVVKLCDFGFARPIATPGEVYTDYVATRWYRAPELLVGDSK
YGKPVDVWATGSLITEMLTGEALFPGDSDIDQLFHITKCLGNLIPRHQELFYKNPLFAGM
KLPEVKELESLEKRYPKLPPAALDLAKECLQIDPDKRPSCAELLQGDFFNKDGFAERFTQ
ELKQKILKDAIRHQFHKKYKINKRDKDDVLQERKMISVQDFTMGPRIKDGKLMKPKLSKA
DAEKADQSSKLGFLYDTTTNQFKFSPQTNLRDSSSSLDYAKNPGTVIPPINQNFSPILGM
GSGPGGLNYRLDGKSQKYLNPLLKARKPSPLARCSVSLTPVTNEKPILQANKKKWEFLKT
NVRLPELSHLPELRGVEARHPRFLKKKNRTFAESRVPSLAAIDLHNSNLASQQLSGTLMP
DASEANFPRVEH
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccatggacaagtaccaggtgctggggctggtgggggaaggcagctacggggtggtg
accaagtgcaggaacagggagagcgggcggatcgtggccgtcaagaagttcctggagagc
gacgacgacgcggcggtgaggaagatcgccctgagggagatcaagctgctcaagcaactc
cggcacgagaatctggtgaacctgcttgatgtgtgtaaaaggaagaagaggtggtacctg
gtgtttgaatttgtggatcacactgtgctcgatgaccttgaggcttctcccaatggattg
gactacgacagggttcggaaatacttgtttcagattatcaggggacttgccttttgtcac
agccataatataatccatcgggatattaagccagaaaacctactggtttcccagtcagga
gttgtgaaactctgtgactttggatttgcccggcccattgcaactcctggggaagtttac
acggactacgtggccacccgctggtacagagccccggagctgctggtgggggacagcaaa
tatggcaagcctgtggacgtgtgggctactggctccctgataacagaaatgcttacagga
gaggcccttttccctggagattcagacattgaccagctcttccacatcaccaagtgcctg
ggtaacttaattccaagacatcaggagttattctataaaaaccccctctttgctggcatg
aagttgcctgaggtgaaggagctggaatccctggagaaacgctatcccaagctccctcct
gccgcactggatttagccaaggagtgcttgcagattgacccagacaagagaccatcctgt
gccgagctcctgcagggcgatttcttcaacaaggatggctttgctgaaagatttacccag
gagcttaaacaaaagatcctgaaagatgccatacgccatcagttccataaaaaatataaa
atcaataaaagggacaaagatgatgtcttacaagaaagaaaaatgatcagcgtccaggat
ttcaccatgggaccaaggatcaaagatggaaagctgatgaagcccaagctctctaaagct
gatgcagagaaagcagatcagtcctccaagctgggctttctctacgacaccacaaccaac
caatttaaattcagccctcagaccaacctgagagattccagcagcagtttggactatgcc
aagaacccaggcacagttatccctcccatcaaccagaacttctctcctatacttgggatg
ggttctgggcctgggggccttaattacagacttgatggaaagagtcagaaatacttgaac
ccgttgctaaaggcacggaagccttctccactggcccgttgcagtgtcagcttgacacca
gttactaatgagaaacccatccttcaggcaaataagaaaaaatgggaattcctcaagaca
aatgtgcgtttgccagaattgagtcatctccccgagctgagaggagtggaagctcggcat
cctagatttctgaaaaagaaaaatagaacatttgcagagtcccgagtcccctccctcgct
gctatcgaccttcataactcaaatctggcttcacagcagctgtcagggaccttgatgcca
gatgcatcagaagccaacttccccagggtcgagcactag

DBGET integrated database retrieval system