KEGG   Ficedula albicollis (collared flycatcher): 101820413Help
Entry
101820413         CDS       T02815                                 

Gene name
ABHD12B
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
KEGG Orthology (KO) [BR:fab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fab01002]
    101820413 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101820413 (ABHD12B)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101820413 (ABHD12B)
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101820413 (ABHD12B)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101820413 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Cutinase Lipase_3 Say1_Mug180 Peptidase_S9 LIDHydrolase PGAP1 DUF676
Motif
Other DBs
NCBI-GeneID: 101820413
NCBI-ProteinID: XP_005047935
Position
5
AA seq 362 aa AA seqDB search
MRRRGGDGDSGDSGDRGGDIGPGQGKSGAALQGRVRRSWLPGLRALLLAPLLTYASVPFL
VRLFPSVLTKFVYLNFLAFPFFVDFRRPELLVNNTISLYLTTEPGVTVGIWHTVPGSRGA
EAQGKDQRWFEEALGDAHPVIIYLHGNGGTRAASHRVQFLKTMGAADFHILALDYRGYGD
STGHPSESGFTTDVLALYDWVKARSENSSIIFWGHSLGTGIATNAARKLQEERGVQVDAV
VLESPYTSIRDAAANIPITKIYRQFPGFESLILDSMARAGMFFRNDENVKVLGCPLLILH
AEDDGVLPPKLGRKLYETAHKAYRDKSKVKFITFPEKLGLGHDYISFNPELPALVKDFLN
KK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtcgcggcggagacggcgacagtggcgacagcggcgacagaggcggcgacatt
ggccccgggcagggcaagtccggcgcggctctgcagggacgggtccggcgctcctggctc
ccagggctgcgtgccctgctcctggccccgctcctcacttatgcctccgtgcccttcctc
gtccgcctcttccccagcgtgctcaccaaatttgtctacctgaacttcctggccttccct
ttcttcgtggactttcggcggccggagctgctggtgaacaacaccatcagcctgtacctc
accaccgagccgggcgtcacagttggcatctggcacacggtgccgggcagcagaggggcc
gaggcgcaggggaaggaccagcgctggttcgaggaggctcttggggatgctcaccctgtg
atcatctacctgcacggcaatgggggcaccagggctgcgagtcaccgtgtccagttcttg
aagacgatgggggctgctgacttccacatcctggctctcgactacagaggctatggggac
tccactggacacccctcagagagtggcttcaccacagatgtcctggcactctatgactgg
gtgaaagcacggagtgagaacagcagcatcatcttctggggacattctttggggacaggg
attgccaccaatgcagcgaggaaactgcaggaggagcgaggggtccaggttgatgctgtg
gtcctggagtctccctacaccagcatccgagacgcagctgccaacatccccatcaccaag
atctaccggcagttcccaggttttgagtccctcatcctggactccatggctcgggcagga
atgttcttccgcaacgatgagaatgtgaaggtgctgggctgccccctcctcatcctgcac
gcagaagatgatggagtcctgcctccaaagctgggacgcaagctctatgagacagcacac
aaagcctacagggacaaatccaaggtgaagttcattacttttcctgaaaagctgggcttg
ggccacgactacatctccttcaacccagagctgcctgccctggtgaaagacttcttaaac
aagaagtga

DBGET integrated database retrieval system