KEGG   Ficedula albicollis (collared flycatcher): 101820476Help
Entry
101820476         CDS       T02815                                 

Gene name
ETNPPL
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00564  Glycerophospholipid metabolism
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101820476 (ETNPPL)
Enzymes [BR:fab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     101820476 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 DUF5017
Motif
Other DBs
NCBI-GeneID: 101820476
NCBI-ProteinID: XP_005044970
Position
4
AA seq 501 aa AA seqDB search
MEELYSKAETLALRRKHIGPSCKVFYAKDPLKIVRAQGQYMFDEKGEKYLDCINNVAHVG
HSHPYVIKAATKQMELLNTNSRFLHDNLVQYAQRLTATLPEKLSVCYFVNSGSEANDLAL
RLARQYRGHQDVITLENAYHGHVTSLIDISPYKFNQLGKDSKKEYVHVAPSPDVYRGKYR
EDHPDPASAYAEEVKKIIEETQKNGRKIAAFIAESMQSCGGQVIPPVGYFQKVAEYVRAA
GGVFIADEVQVGFGRVGKHFWAFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTREIAEGF
GASGLEYFNTFGGNPVSCAVGLAVLDVIEKEDLQGNATRVGNYLLELLAEQKEKHPLVGD
IRGVGLFVGVDLVKDRQKRTPATAEALHLIYKLKERQILLSADGPYRNILKFKPPMCFTM
EDAKHAVETLDALLTEMEEATGMKTENNASTNVQCKRKTTEESSQPEGASESISHVNGAA
CRQENGIYSKKRSVPSKRIRT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctctacagcaaggcggagaccctcgcccttcggaggaagcacatcgggcct
tcctgcaaagttttctatgccaaggaccctctgaagatagtccgtgctcagggccaatat
atgtttgatgagaaaggagaaaaatacttagactgcatcaacaacgttgcacatgtgggc
cacagccatccatatgtgataaaggctgcaacaaaacagatggaactgctcaatacaaac
tcccgtttcctgcatgacaaccttgttcagtatgcacaacgtctcacagccaccctgcct
gagaaactctctgtttgctattttgttaactctgggtctgaagcaaacgaccttgcttta
cgactggctcggcagtaccgcgggcaccaagatgtgatcaccctggagaatgcttaccat
ggccatgttacatctctgattgacatcagtccctataaatttaatcagctgggaaaggac
agcaagaaggagtatgtgcatgtggctccttctccagatgtctacagagggaaatacagg
gaggaccacccagatccagcaagtgcttatgctgaagaggtgaaaaagattattgaagaa
acacagaagaatggacgcaagattgctgccttcatagctgaatccatgcagagctgtgga
ggccaagtaattccacctgtgggctatttccagaaagtggcagagtatgtgcgtgcagca
ggtggagtgttcattgctgatgaggtccaggttggctttggcagagttgggaagcatttc
tgggcattccagctgcaaggtgaagactttgtgcctgacattgtcaccatgggaaagccc
attggcaatggacacccaatgtcttgtgtggtcacaacaagggaaattgctgaaggtttt
ggtgcttctggactggagtatttcaatacatttggaggcaacccagtgtcttgtgccgtt
ggcttggctgtgctggatgtaatagagaaagaagatctccaagggaatgccacacgggta
ggaaattatctcctggagttgctggctgagcaaaaggagaaacatcccttagtgggagat
atcaggggtgttggattgtttgttggagtggatctggtgaaagataggcaaaagcggaca
ccggccacagctgaagctcttcatcttatttacaaactcaaagagcgccaaatccttctt
agtgcagatggaccctacagaaatattttaaaatttaaaccaccaatgtgtttcacaatg
gaagatgcaaaacacgcagtggagacacttgatgcacttcttacagaaatggaagaggcc
actggaatgaagacagaaaataatgcatctacaaatgtacagtgtaaaagaaaaacaact
gaagagagttctcaaccagaaggtgcaagtgaaagcatcagccacgtgaatggagctgcc
tgccgacaggaaaatgggatttattcgaaaaagcgctcagtgccaagtaaaagaataaga
acgtga

DBGET integrated database retrieval system