KEGG   Ficedula albicollis (collared flycatcher): 101820744Help
Entry
101820744         CDS       T02815                                 

Gene name
PCBD1
Definition
(RefSeq) pterin-4 alpha-carbinolamine dehydratase 1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00790  Folate biosynthesis
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101820744 (PCBD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fab04147]
    101820744 (PCBD1)
Enzymes [BR:fab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     101820744 (PCBD1)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101820744 (PCBD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 101820744
NCBI-ProteinID: XP_005048027
Position
6
AA seq 104 aa AA seqDB search
MAGKAHRLSTEEREQLLPNLRAVGWNEVEGRDAIFKEFHFKDFNRAFGFMTRVALQAEKL
DHHPEWFNVYNKVHITLSTHDCGGLSERDINLASFIEQVAASLS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaagcccacaggctgagcacagaggagagggagcagctgctgccaaacctg
cgagccgtggggtggaacgaggtggaaggcagagatgccatcttcaaagagttccacttc
aaggacttcaaccgggcctttggcttcatgaccagagtggctctacaggcagaaaaactg
gatcatcatcctgaatggttcaatgtgtacaataaggttcacatcaccttgagcacccac
gactgcgggggcttatcggagcgagacatcaacctggccagcttcatcgagcaggtggca
gcttccctctcctga

DBGET integrated database retrieval system