KEGG   Ficedula albicollis (collared flycatcher): 101821460Help
Entry
101821460         CDS       T02815                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00564  Glycerophospholipid metabolism
fab00565  Ether lipid metabolism
fab00590  Arachidonic acid metabolism
fab00591  Linoleic acid metabolism
fab00592  alpha-Linolenic acid metabolism
fab01100  Metabolic pathways
fab04010  MAPK signaling pathway
fab04217  Necroptosis
fab04270  Vascular smooth muscle contraction
fab04370  VEGF signaling pathway
fab04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101821460
   00565 Ether lipid metabolism
    101821460
   00590 Arachidonic acid metabolism
    101821460
   00591 Linoleic acid metabolism
    101821460
   00592 alpha-Linolenic acid metabolism
    101821460
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101821460
   04370 VEGF signaling pathway
    101821460
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101821460
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101821460
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101821460
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101821460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 101821460
NCBI-ProteinID: XP_016154033
Position
5
AA seq 812 aa AA seqDB search
MGSNLSTSETFTSTSAPAVRTAPVSPFNLLTVKILRVRNVRKADFLTLSDCYVTLWLPTA
SAEKVRTRTIRNSKNPVWNEAFCYKIDRRVKNVLELKVCDEDTVTRDDELCTVLFDIDKL
TIGRTVRVKFQLNPQAREELEVEFTLQNTLDYPDGIITNGVLVAREVSCLEVRVDTGKLK
QQSTNPELTFTVKGSHEGSQKILLDSGPSLHIIIFHCIINDQTRLDILLPEELVDGNETE
KSGVLSFPLNSLPLQKEIILEEDNSFHLCLTARKCSGDLDVRLGFSLCMEEQDFLRKRKK
YVAAALKKILNLEEDLKEHEVPVVAITTTGGGTRSLTAMYGSLLGLQKLNLLDCISYIGG
LSGTTWTMANLYEDANWSQKYLEDAIKEARKQVTKSKICCFSWDCLKYYYNDLMERTKEG
HNTSFIDLWGLVIESMLHDKKDEHRLSDQRQAVENGQNPLPIYVAINLKSNYSAQAFREW
LEFTPYEVGLLKYGASIRAEHFGSQFFMGRMVKKLSETRICYMQGMWSSIFSIDVMYVWN
LAADSEDFWCRWTRDRVKDIAEEPFLSVNPYEVDTCLFTPSSVLSSTLRDVLTGRPTIAQ
YPNFIRGFQLHNKYLESEGFSTWKDTVIDCLPNKLMETADSELSLVDTGFFINTSYPPLL
RSKREVDVILHLNYSGGSQTLPLDQIAKYFSEQEIPFPKIEISEEDRENLKECYVFEEAD
SPQAPTVLFFPLVNDTFKKYKAPGVERSPEEMAEGKVDVSSILSPFTTREVCFSEENFDK
LVKLTDYNVLNNEKLIIQALRLAVARRKQRSY
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaaatttaagtacaagtgagacttttacgagcacctcagcaccagcggtgaga
acggcaccagtatcacctttcaacttgctcactgtaaaaatactaagagtgaggaatgtc
cggaaggcagactttctcaccctttcagactgctacgtgacactgtggctgcccactgcc
tcagcagagaaggttcggaccaggaccatcaggaacagcaaaaaccccgtgtggaatgag
gctttctgctacaagatcgaccgccgagtcaagaacgtgctggagctgaaggtctgtgat
gaagacacggtcaccagggatgatgagctctgcacagttctctttgacatagataaactc
actataggacgcactgtccgtgtgaagtttcagctgaatccacaggcacgtgaggaactg
gaggtggaattcacattgcagaacactctggactatcctgatggcatcattacaaatgga
gtactagtggcacgtgaggtttcctgtttggaggttagagtggatacagggaagctgaag
cagcaatccacaaacccagagcttacatttacagtgaaaggatcacatgaaggaagccag
aaaattttgctggactctggccccagccttcatataatcatatttcactgcatcataaat
gaccagacaagactggatatcctattaccagaagagctggttgatggaaatgaaacagag
aaatctggggtcctttctttccccctgaattcactccctttgcagaaagaaatcatacta
gaagaggataactcatttcacttgtgcttgacagcaagaaaatgctcaggagacctggac
gtgcgcttggggttcagcctgtgcatggaagagcaggacttcctgaggaaaaggaagaaa
tacgttgctgctgctctgaaaaagattcttaatttggaggaggatctgaaagagcatgag
gtgcccgtggtggccatcaccacgaccgggggaggaacgcggtcgctcacggcgatgtac
ggcagcctgctgggcctgcagaagctcaacctgctcgactgcatttcctacatcggcggc
ttatcgggcaccacatggaccatggcaaacttatatgaagatgctaattggtcacaaaaa
tatctggaggatgcaatcaaggaagctcgcaagcaagtaaccaaatccaagatctgctgt
ttttcttgggattgtctgaagtactattataatgacctgatggagaggactaaagaagga
cataacacttctttcatagacctttggggtcttgtcattgaatccatgctacacgataag
aaagatgagcacagactctcggaccaacggcaggcggtggaaaatggccagaacccactg
cccatctatgtggccatcaacctcaagtccaactatagtgcccaggctttcagagagtgg
ctggagttcactccttatgaagttggtctgctgaaatatggagcttctatccgcgcagaa
cactttggaagccaattctttatgggaaggatggtgaagaagctctcagagactcggatc
tgctacatgcaaggcatgtggagcagtattttttccatagatgtcatgtatgtctggaat
ttggctgctgattcagaagatttctggtgcagatggaccagagatagagtaaaagatatt
gcagaagaaccctttctgtctgtgaatccctatgaagtagacacgtgtctgttcaccccc
tcgagtgtgctctcctctactctccgggatgttttaacaggacgtccaaccattgcacag
tatcccaatttcatcagaggcttccagctgcataataagtacctggagagtgagggattt
tctacctggaaagacacagtgatagactgcctcccaaataaactgatggaaacagcagac
agtgagctctccctggttgatactggctttttcattaataccagctacccaccacttttg
aggtcaaagagggaggtcgacgtcatcctgcatttgaattacagtggagggtcccaaaca
ctgcctctggatcagattgcgaagtacttctcagagcaagaaattccatttcccaaaatt
gagataagtgaggaagacagggaaaacttgaaggagtgctatgtgtttgaagaggctgac
agtccacaagctccaacagtacttttttttcccctagtaaatgacaccttcaagaaatat
aaagctcctggtgtggaaaggagtcctgaagagatggctgaaggcaaagttgatgtctcc
agcatcctctccccatttacaacaagggaggtgtgtttcagtgaagagaattttgacaaa
ctggtgaaactgactgattacaatgtcctgaacaatgagaagctgattattcaggccttg
cgcttggcagtggcacggaggaagcagcgcagttattaa

DBGET integrated database retrieval system