KEGG   Ferroplasma acidarmanus: FACI_IFERC01G1543Help
Entry
FACI_IFERC01G1543 CDS       T02713                                 

Definition
(GenBank) carbon-nitrogen hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
fac  Ferroplasma acidarmanus
Brite
KEGG Orthology (KO) [BR:fac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FACI_IFERC01G1543
Enzymes [BR:fac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     FACI_IFERC01G1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AGO61523
UniProt: S0AQK2
Position
complement(1502421..1503236)
Genome map
AA seq 271 aa AA seqDB search
MIFILIQVIYAMVKIALTQLKPVADKDVSLRNIEYYAGTAAANSADLIVFPEYYMFYSQY
KDAIIRNAEVLNGNYIKRIKEISRTNKIGIITGINEVYDHNYYDTAVYVNDGELLNYYRK
SHLYDAFGYRESDIYTYGNGPFKISKIGNINFGMLICYDIRFPEVFRNYSLNDADMVILI
SAWFAGPIKEEQWLSLVSTRALENTTYLATSNMIGGGFTGITTFTDPIGAIINRAAEDED
IIYSIIDTNRISTVRKKMPVLKQRRPELYKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgatttttatattaatacaggttatatatgctatggtaaaaatagcactcacacaatta
aagcctgtagcagacaaggatgtaagcttaagaaatattgaatattatgctggcactgcg
gctgcaaattccgctgatttaatagtatttccagaatattatatgttttattcacagtat
aaggatgctataataagaaatgcggaggtgcttaatggcaattatataaaaaggataaaa
gagatatccagaaccaataaaatcggcataataactggcatcaatgaggtctacgaccat
aattattacgatactgccgtatatgtaaacgatggtgaattattaaattattacagaaaa
tcgcatctgtacgatgcttttggataccgggaatccgatatttatacatatggaaatgga
ccatttaaaatttcgaaaataggaaatataaattttgggatgttaatatgttatgatata
agatttcctgaggttttcaggaattactcacttaatgatgcggatatggttatactgatt
tcagcatggtttgccggccctataaaagaggagcaatggttatcacttgtatccacaagg
gcactagagaatacaacatacctggctacttctaacatgattggcggtggctttactggc
ataactacatttaccgaccccataggagctataataaatagggcagcagaagatgaagat
attatttattcgatcattgatacaaacaggatatcaactgtaaggaaaaaaatgccggtt
ttaaaacagaggaggccggaattatataaactgtga

DBGET integrated database retrieval system