KEGG   Francisella adeliensis: CDH04_04875Help
Entry
CDH04_04875       CDS       T06148                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fad  Francisella adeliensis
Pathway
fad00480  Glutathione metabolism
fad00590  Arachidonic acid metabolism
fad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CDH04_04875
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CDH04_04875
Enzymes [BR:fad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CDH04_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: AXA33787
UniProt: A0A2Z4XY04
Position
1000113..1000586
Genome map
AA seq 157 aa AA seqDB search
MNSIYDFKLTTNDGKEFNLPKNKVLLIVNVASKCGFTKQYRGLQHLHEIYPDLEIVAFPC
NSFGGQEPAVDGEIKNFCETEFGITFPIMKKTKVNGKDAEPLFDYLKEHAKGILGTERIK
WNFTKFLVCKDGKTVQRYAPKTIPEELIPDIDNFLKD
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatttatgattttaaactcacaactaatgatggtaaagagtttaacttacct
aaaaataaagtccttttaatcgtgaatgtagcaagtaaatgtggctttactaaacaatat
agaggcttacaacatcttcacgaaatttatcctgatttagaaatagttgcatttccgtgc
aattcttttggtggacaagagccagcagtagatggagagataaagaatttctgtgaaaca
gagtttggaattacattccctataatgaaaaaaactaaagttaatggtaaagatgctgag
ccattatttgattacttaaaagagcatgcaaaaggcatacttggcacagaaagaatcaaa
tggaactttacaaagtttcttgtttgtaaagatggtaagacagttcaaagatatgctcct
aaaactataccggaagaacttatacctgatatagacaatttcttaaaagattag

DBGET integrated database retrieval system