KEGG   Fibrella aestuarina: FAES_0471Help
Entry
FAES_0471         CDS       T02429                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fae  Fibrella aestuarina
Pathway
fae00260  Glycine, serine and threonine metabolism
fae00750  Vitamin B6 metabolism
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01230  Biosynthesis of amino acids
Module
fae_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FAES_0471 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FAES_0471 (thrC)
Enzymes [BR:fae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FAES_0471 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Nop10p
Motif
Other DBs
NCBI-ProteinID: CCG98482
UniProt: I0K2X9
Position
complement(603483..604847)
Genome map
AA seq 454 aa AA seqDB search
MVCCNRLFARNLRALLPDYAMTFYSTNDATNVVSVQEALFNSMPQDRGLYMPSAIPALPA
GYLNSLPGKSFADIAYDLTKLWLTGDLTDAQVAQLVEQAFPFDTPLVELEAGRKYVLELF
HGPSLAFKDVGARFMAGLMSIFSASYDKEVHILVATSGDTGGAVAMGFHNVPGVRVSILY
PKGRVSLLQEKQLTTLGGNVQAFEVDGSFDDCQALVKTAFLDQELNQTFALSSANSINIF
RLIPQSFYYFRALAQLAPNHKPVVFSTPSGNFGNLSAGVLGWRMGLPVEAFVAATNLNKV
VPDYLSSGTYEPMASLATLSNAMDVGNPSNFSRLKRLLGDDYASITDRIKGYYFTDDQTI
DEIKRLRDVYNYVACPHTAVGLLGLESYQHFAVDNCGIALATAHPAKFSPAVDEILGQAV
DVPERLAILANRTKQAIAIPGTFEAFKESLLQTA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggtatgctgtaaccgactgtttgcacgtaacttgcgtgctcttttgcccgattacgct
atgactttctacagtactaatgacgcaacaaatgttgtttcggttcaggaggcattgttt
aacagtatgccccaggatcgtggattatacatgccctcggcaattccggcgttaccggct
ggctatctgaattcgctgcccggtaaatcgtttgctgacattgcctacgacctgaccaag
ctctggctaaccggcgatctgaccgacgcacaagtagcccaattagtcgagcaggccttc
ccgttcgacacgcccctcgttgagctggaagcgggccggaaatacgtgcttgaactcttt
cacggtccttcgctggctttcaaagatgtgggcgctcgttttatggctggcttgatgtcg
atcttttcggcgtcgtatgataaggaggttcatatcctggtggcgacctctggtgatacg
ggcggagctgtcgcgatgggtttccacaacgtacctggcgtgcgggtttccattctctat
ccgaaaggacgggtcagcttgttgcaggaaaagcagctgacgacgttgggcggcaatgtg
caggcctttgaggtcgatggttcgttcgacgattgtcaggcgttggtcaagacggcattt
ctggatcaagaactgaaccagacttttgccttgtcgtcggctaattcaattaacatcttc
cggcttattccgcaaagcttctattatttccgcgccttggctcaactggcacctaaccac
aagccggttgttttctccacgccttcgggcaacttcggtaaccttagcgccggggttctc
ggctggcgaatgggactacccgttgaggcctttgtggcagcgaccaatttgaacaaagtt
gtgcctgattatctgtcgtcaggtacgtacgaaccaatggcttcactggctacgctctcc
aacgcgatggatgtaggtaacccaagcaatttcagccggctaaaacggttgctgggggat
gattatgcttcaattaccgatcgcataaaaggctactatttcactgacgatcagactatt
gatgagataaaaaggcttcgcgatgtgtataactacgttgcttgtccccatacggctgtt
ggtttattgggccttgaaagttatcaacattttgctgtggataactgtggaattgcgttg
gcaactgctcatccagccaaatttagcccggcggttgacgagattttgggacaagctgtc
gacgtacctgagcggcttgctatactggccaatcgcaccaaacaagcgattgccattcca
ggtacgttcgaggcgtttaaagaatcacttctccaaacggcataa

DBGET integrated database retrieval system