KEGG   Fibrella aestuarina: FAES_0482Help
Entry
FAES_0482         CDS       T02429                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fae  Fibrella aestuarina
Pathway
fae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01130  Biosynthesis of antibiotics
fae01230  Biosynthesis of amino acids
Module
fae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FAES_0482
Enzymes [BR:fae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FAES_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS RTX FMN_dh
Motif
Other DBs
NCBI-ProteinID: CCG98493
UniProt: I0K2Z0
Position
complement(622378..623205)
Genome map
AA seq 275 aa AA seqDB search
MTILDTIIARKREEVAHRKAAVSEAELRQAPLFGRAVNSARAALLAPGSSGVIAEYKRKS
PSKGVINDRHSVTETTAGYVASGAAVLSVLTDEPFFGGTPADLQAARASNPTTPILRKDF
VIDGYQLLEAKAWGADLVLLIAACLSPAEVRSLSQQAQELGLEVLLEVHDADELQRSLCE
TVDLVGVNNRNLKTFVTSIDTSLQLADQIPDQFVKVTESGLQDAATMVKLYTAGYRAFLI
GEAFMKTNDPAAALTSLLADYQQQRTTCTQSSLTV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccattctcgatacgattattgcccgcaaacgggaagaagttgcccaccgtaaggcc
gccgtttcagaagcagaattacgtcaggcaccgctgttcgggcgggcggtcaattcggca
cgggcggcgctgctggccccgggctcgtcgggcgtgattgccgagtacaagcggaagtca
ccttccaagggggtcatcaacgatcggcattcggtcaccgaaacaacggctgggtacgtt
gcgtcgggtgcagccgtactgtcggtgctgaccgacgaaccgttttttgggggtacgccg
gccgatttgcaggcggcacgggcaagcaacccaaccacccccattctacgtaaagacttc
gtaatagacggctatcagttgctggaggcgaaagcctggggtgccgacctggtgctgctc
atcgcggcctgcctgtcgcccgccgaggtacgttcgttgagtcagcaggcgcaagagcta
ggcctggaggttttgctggaagtacacgatgctgacgaattacaacgttctttatgcgaa
accgttgatctggtgggtgttaacaaccgaaacttgaagacctttgtgacctcgatcgat
acgtcgcttcaactcgctgatcagattcccgaccagtttgtgaaggtgactgaaagtggc
ttgcaggatgccgctacgatggtgaagctctacacagcgggctatcgggccttcctgatt
ggcgaggcgttcatgaaaaccaacgacccggccgccgccctgaccagcctgctcgccgat
taccaacagcaacgtacaacctgtacccaatcgtctctgaccgtatga

DBGET integrated database retrieval system