KEGG   Fibrella aestuarina: FAES_0486Help
Entry
FAES_0486         CDS       T02429                                 

Definition
(GenBank) DNA-formamidopyrimidine glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fae  Fibrella aestuarina
Pathway
fae03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:fae00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    FAES_0486
Enzymes [BR:fae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     FAES_0486
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     FAES_0486
DNA repair and recombination proteins [BR:fae03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     FAES_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS zinc-ribbons_6 DNA_ligase_ZBD FbpA zf-NADH-PPase Auto_anti-p27 DUF2116 zf-TFIIB zf-ribbon_3 zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: CCG98497
UniProt: I0K2Z4
Position
626870..627688
Genome map
AA seq 272 aa AA seqDB search
MPELPEVEIRRMYLEATSLAQPIDSITVEDKKLLTTEFDTLYEKLEGRQFTHTRRVGKNL
FIYTDDPRVILRMHFGMTGDLEYYHNSVDRPRHARIVFYFTNGFCLGFICPRKFERIGLV
NDVDEFLRLKKIAPDALSIELGTLRDKLKKRRSPIKPVLLDQSTTAGLGNWIVDEVLFQA
KVHPSAVSAELSEAEVEAIHEAIQLVLKTAIAKEAVYKDFPRSFLIHVREWDDSPYDDVE
AHKVCPRCGTPIERTEVGGRTTFFCPNEQVLG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactacccgaagtcgagatccggcggatgtacctggaggccacctcgctcgcc
caacccatcgactccatcactgtcgaagacaagaaactacttaccaccgaattcgatacg
ctttacgaaaaactcgaaggtcgccagttcacccatacacgccgggttggtaaaaacctg
ttcatctacaccgacgacccccgcgtgattttgcggatgcatttcggcatgaccggcgac
ttggagtattaccacaactccgtcgaccggccgcggcatgcgcgcatcgtcttttacttt
actaacggcttttgtctaggcttcatctgcccccgcaaatttgagcggatcgggctggtc
aacgacgtcgatgaatttctgcggttgaagaagattgcgcccgatgcgctgtctattgag
ctgggtacgttgcgggacaagctgaaaaagcgccgatcgcccatcaaacccgtgctgctc
gaccagtcgacgaccgccgggctgggaaactggattgtcgatgaagtcttgtttcaggcc
aaggttcacccatcggcggtcagcgctgagttgtcggaggccgaagtcgaagcaattcat
gaggccattcaactcgtgctgaaaacggccatcgcgaaggaagcggtctacaaagatttc
ccgcgttcgtttctgatccacgtgcgcgagtgggacgattcgccctacgacgacgtggaa
gcgcacaaggtttgcccgcgttgcggtactcccatcgaacgaaccgaagtgggtggccgt
acgacctttttctgccctaacgaacaggtacttgggtaa

DBGET integrated database retrieval system