KEGG   Fibrella aestuarina: FAES_1298Help
Entry
FAES_1298         CDS       T02429                                 

Gene name
pit
Definition
(GenBank) Low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
fae  Fibrella aestuarina
Brite
KEGG Orthology (KO) [BR:fae00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FAES_1298 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCG99308
UniProt: I0K5A5
Position
1606543..1607973
Genome map
AA seq 476 aa AA seqDB search
MFGLETGIFLLLALCVLAALAFEFINGFHDTANAVATVIYTNSLQPTQAVVWSGIVNFIG
VVTGGVGVGMSIVNLLPVELLVDQNVYHSIAMVLALLLSAIIWNFGTWYFGLPASSSHTL
IGAILGVGLGFALLPENTMGVAAVNWDKAKEVFLALFLSPLIGFSLAVILMFVLRRVLSR
PIRKQIFDEPHPGQTPPGWIRILLIITCTLVSFFHGRNDGQKGIGLLMLILIGILPTYFS
IDTRLDIKQLQPDLAVVEQKIGAIDKSQLAKSELERIQKIDTSLANLRPVVTSGTYPQKD
AILIRKALLTISSNVKALIGSESVKLSAADKSALSKAATIEEEGLRKYTDHAPFWVILMI
SLSLGFGTMIGWKRIVVTVGEKIGKSHLTYAQGASAELVAATTIGLASGLIPGFKAPVST
THALSSGIAGAMVASKGIKNLQAKTVQSIALAWVLTLPAAILLSATLFWILRWLLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcttagagaccggcatttttctcctcttggctctttgcgtcctcgccgcacta
gccttcgaattcatcaacggctttcacgatactgccaacgccgttgccaccgtcatttac
accaattcgcttcaacccacgcaggccgttgtctggtcggggattgtcaactttattggc
gttgtgacgggcggcgtaggggtcggtatgagtatcgtcaacctgcttcccgttgaactg
ttggtcgaccagaacgtgtatcatagtatcgcgatggtgctggcgctgttgctgtcggcc
attatctggaacttcggcacctggtattttggcctgcccgcctccagttcgcacacactc
attggcgccattctgggcgtgggactgggctttgcgctacttcccgaaaacacgatgggc
gtcgcggctgtcaactgggacaaggcgaaagaggtttttctggccttgttcctgtctccg
ctcattggctttagtctcgccgttattctgatgtttgtgttgcggcgcgtattgagccga
cccattcgcaagcagattttcgacgaaccacatcctggacagaccccgcccggctggatt
cggatcctgctcattatcacctgtacgctggttagtttctttcatggccgcaacgacggg
cagaaaggcatcgggctgctcatgctgatcctaatcgggattctgcccacatacttttcc
atcgatacccgtctcgacatcaagcagctacaacccgacttagcggttgttgagcagaaa
attggtgccattgataaatcgcagctggctaaatcagaactggaacgtatccagaaaatt
gacaccagccttgctaacctgcgcccggtggtgaccagtggaacgtatccacagaaagac
gctatcctgattcggaaggcgctgcttaccatcagcagtaacgtgaaagcgctgatcggc
agtgaaagcgttaagctgagcgccgccgacaaatcagcgctgtccaaagccgccacgatt
gaagaagaaggccttcgtaaatacaccgaccatgcgcccttctgggtcatcctgatgatt
tccctgtcgctgggctttggcaccatgatcggctggaaacggattgtggtaacggtaggg
gagaagattggtaaatcgcacctgacctacgcgcagggggcatcggccgagttggttgcc
gccaccacgattgggctggcttcgggcttgattcccggctttaaagcacccgttagcacc
acacacgcgctgtcgtcgggtattgcgggggccatggtggcgagcaaaggaatcaagaat
ttgcaggctaaaaccgtgcagagtatcgcactcgcctgggtgctgactctcccggctgcc
attctgctttccgctaccctgttctggattctccggtggctactggggtaa

DBGET integrated database retrieval system