KEGG   Fibrella aestuarina: FAES_1443Help
Entry
FAES_1443         CDS       T02429                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fae  Fibrella aestuarina
Pathway
fae00040  Pentose and glucuronate interconversions
fae00052  Galactose metabolism
fae00500  Starch and sucrose metabolism
fae00520  Amino sugar and nucleotide sugar metabolism
fae01100  Metabolic pathways
fae01130  Biosynthesis of antibiotics
Module
fae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FAES_1443
   00052 Galactose metabolism
    FAES_1443
   00500 Starch and sucrose metabolism
    FAES_1443
   00520 Amino sugar and nucleotide sugar metabolism
    FAES_1443
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FAES_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Smr tify
Motif
Other DBs
NCBI-ProteinID: CCG99453
UniProt: I0K5Q0
Position
1782996..1783856
Genome map
AA seq 286 aa AA seqDB search
MIKKAVIPAAGLGTRFLPATKAQPKEMLPIIDRPTIQYVVQEAVDSGIEDILIITGKGKR
AIEDHFDRNYELESRLAEKEDRLLLDEMRRLSDMANLHYVRQRELNGLGDAIRYARQHVG
NEPFAVLLGDTIMDAVMPVTQQLIDTYEQYGGSVIAVEEVPADKVNRYGIVGGRALSERI
MALDTLIEKPSIEEAPSNLAIAGRYVLTPDVFDALDRTPVGKNGEVQLTDALKLMLTREN
LFAHRIEGKRHDIGNKLDFLKTTVEFALKRPEFAEPFRTYLKSLNL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaagccgttattcccgccgctggcctgggcactcgttttctgcccgccacc
aaagcccaacccaaagaaatgctgccgatcatcgaccggcccaccatccagtatgtggtg
caggaagccgtcgattcgggcattgaagatatcctgattatcacgggaaaaggcaaacgc
gccatcgaagaccacttcgaccgcaactacgaactggagagccgcctcgccgaaaaggaa
gaccggctgctgctcgacgagatgcgccgtctctcggatatggccaacttgcattacgtt
cggcaacgcgaactcaacggtcttggcgacgccattcgctatgcccggcaacacgttggc
aatgagccgttcgctgtgctgttgggtgataccattatggatgccgttatgcccgtgacg
cagcaattgatcgatacctatgagcaatatggcgggtcggtgattgcggtggaagaagtg
ccggccgacaaagtgaaccggtatgggattgtgggtggccgagccctgagcgaacgcatt
atggccctcgacaccctgatcgaaaaaccgtccatcgaggaagcacccagcaacctggcg
attgcgggtaggtacgtgctcacgcccgacgtgttcgacgcgctcgaccgcacacccgtc
ggcaaaaacggcgaggtgcaactcaccgacgccttgaagctgatgctcacccgcgaaaac
ctgtttgcacaccgcatcgaaggcaaacgccacgacatcggtaacaaactcgacttcctg
aaaaccaccgtcgaatttgcgctcaaacgccccgaattcgccgaacccttccgaacctac
ctgaaaagcctcaacttgtaa

DBGET integrated database retrieval system