KEGG   Fibrella aestuarina: FAES_1589Help
Entry
FAES_1589         CDS       T02429                                 

Gene name
asnB
Definition
(GenBank) asparagine synthase (glutamine-hydrolysing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fae  Fibrella aestuarina
Pathway
fae00250  Alanine, aspartate and glutamate metabolism
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FAES_1589 (asnB)
Enzymes [BR:fae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     FAES_1589 (asnB)
Peptidases [BR:fae01002]
 Cysteine Peptidases
  Family C44
   FAES_1589 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC NAD_synthase tRNA_Me_trans DUF1933 ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: CCG99599
UniProt: I0K646
Position
1977735..1979588
Genome map
AA seq 617 aa AA seqDB search
MCGIAGLVARRQPLADPQLVERMTGAMPHRGPDASGLWSEGPIALGHRRLSIIDLNEAAN
QPLADGAGRYRLVFNGEIYNYRELRAQLSGYPFRTQSDTEVLLAAYTRWGTGCLQHLNGM
FAFALWDRQTQQLLLARDRMGKKPLYYYLDDQHLLFASEVRALLQTGLVPRRLNDSALPT
YLMYQTVPSPDTLVQNVRQIEPGHYALFARDQWVEQPYWDLLQPTPADPVLLSSATAVRA
EVRRLMQGAVARRMVSDVPFGAFLSGGVDSSAVVALMAQQSEQPVNTFTISFAEQQVDES
AQARQLARRFNTRHTDLCLRPTDLLAELPKLLASMDQPSGDGPNTYMVSKLTKEAGITVA
LTGLGGDELFAGYSTFGRYARLRQLRWLWQLPEGLRRPVLNTVLRTINPTKRQALIQLPS
LAPPRLFSLFRQSFTASEVATLLGPTGANPVADWLTRHDTDLRRLPTLSQVSVSELMSYA
MPLLLRDADQMSMAHALELRVPFFDYTLIEFLLQVPDTYKAASPPKRLLVDALRPLLPES
VLQRPKMGFSFPWASWLRGDLRAFCQQRLAQLAQRDLFRPGTIEAMWATFLRAEPGSSWN
QLWLLVTLDDWLERHGV
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagctgggttagtagctcgtcggcaacccctggccgatccacaactggtc
gagcgcatgaccggggcgatgcctcaccgcggccccgatgccagtggcctctggagcgaa
gggcccattgccctggggcatcgccgcctgtcgatcatcgacctcaacgaagcggccaac
cagccgctggccgatggggcagggcggtatcggcttgtcttcaacggggaaatttacaac
taccgcgagctgcgcgctcaactgtctggttatccgtttcggacgcagtcggataccgag
gtgttgctggccgcttacacgcgctggggcacgggttgccttcagcacctgaacgggatg
tttgcctttgcgctctgggatcggcagacccaacaactgctactggcccgcgaccggatg
ggcaagaaaccgctgtactattacctcgatgatcaacacctgctgttcgcttcggaagtg
cgggcgctgttgcaaaccggcctggtgccgcgtcggctgaacgacagcgcgttaccaacg
tacctgatgtaccagaccgtgcccagccccgacacgctggtacaaaacgtgcgtcagata
gaaccggggcattatgccctgtttgcccgggaccaatgggttgaacaaccttactgggac
ttgctccaaccaacccccgccgacccggtgttactcagcagcgcaacggccgttcgggcc
gaagtgcgtcggctgatgcagggcgcggttgcccgccggatggtcagcgatgtaccgttt
ggcgcttttttgtcgggcggcgtcgattcgagtgccgtggtggcccttatggctcagcaa
agtgaacaacccgttaacacattcacgatttcgtttgcggaacaacaggtcgatgagtcg
gctcaggcgcggcagctggcccggcgattcaacacgcgccatactgacctatgcttacgc
cccactgacctgctggccgaattaccaaagctgctggctagtatggatcagcccagtggc
gatggccctaacacctacatggtgtcgaaactcacgaaagaggcggggattacggtggca
ctgactggcctggggggcgacgagttgtttgcgggctactcgaccttcgggcggtatgcg
cggctgcggcagttgcgctggctgtggcagttgcccgaagggctgcggcggccggtgctg
aacaccgtcctgcggacaattaacccgaccaaacggcaggcgctgatccagttgccatcg
ctcgctccgccccggctattttcgcttttccggcaatcgtttaccgcgtccgaagtagcc
accctactaggcccgacaggcgcgaaccccgtggccgattggctgacccggcatgacacc
gacctgcgtcgcctccctaccctgagtcaggtgagtgtaagtgagttgatgagctacgcc
atgccattgctgctccgcgacgctgaccagatgagcatggcgcacgcgctcgaactccgc
gttccctttttcgattatacgctgattgagtttttgttgcaggtgcccgatacctacaaa
gccgcctcaccgccgaagcgtctgctcgtcgacgcccttcggccgttattgcccgaaagt
gtgttacagcggcctaaaatgggcttcagctttccgtgggcatcctggctgcgtggcgac
ctgcgggccttttgccagcaacggctcgcgcaactggcgcagcgtgacctgtttcggccc
ggtacgatcgaagcgatgtgggctacctttttacgggccgaaccgggcagtagctggaat
cagctctggctattagtcacgctcgacgattggcttgagcggcatggcgtctga

DBGET integrated database retrieval system