KEGG   Fibrella aestuarina: FAES_1782Help
Entry
FAES_1782         CDS       T02429                                 

Definition
(GenBank) nucleotide sugar dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
fae  Fibrella aestuarina
Pathway
fae00040  Pentose and glucuronate interconversions
fae00053  Ascorbate and aldarate metabolism
fae00520  Amino sugar and nucleotide sugar metabolism
fae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FAES_1782
   00053 Ascorbate and aldarate metabolism
    FAES_1782
   00520 Amino sugar and nucleotide sugar metabolism
    FAES_1782
Enzymes [BR:fae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     FAES_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C NAD_binding_2 ApbA 3HCDH_N F420_oxidored NAD_Gly3P_dh_N Pyr_redox TrkA_N Pyr_redox_2 FAD_binding_3 cEGF
Motif
Other DBs
NCBI-ProteinID: CCG99792
UniProt: I0K6N9
Position
2222086..2223399
Genome map
AA seq 437 aa AA seqDB search
MKIAVVGTGYVGLVTGTCFAETGNQVTCVDIDERKVEKLNNRIIPIYEPGLDVLFYRNVE
EGRLKFTTNLAEGIKGAEVIFLALPTPPGEDGSADLKYILGVANDLGPILEQYAVIVDKS
TVPVGTAEKVHAGIAKNAKVDFDVVSNPEFLREGVAVEDFMKPDRVVIGTKSDKAKAVMN
RLYAPLVRQGNPVIFMDERSAEMTKYAANAFLATKITFMNEIANLCEKVGANVDDIRKGI
GTDSRIGKRFLFAGIGYGGSCFPKDVQALAKTAQEYDYDFRVLKSVMDVNAGQKKRLLPV
IKQHFGGDLKGKTIAIWGLAFKPYTDDIREAPALDNIRDLLAEGAKITAYDPEAMENVRN
ILGNQVTFAHTSYAALDDADALVIMTEWPMFRTPEFEKMNLLLKNKVIFDGRNVYELDQM
RELGYTYYSIGREAVTH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctgtagtaggtacggggtatgtggggctggttacaggcacctgcttcgcc
gaaaccggtaaccaggtaacctgcgtcgacatcgacgaacgtaaggttgaaaaactcaac
aatcgcattattcccatttatgaaccgggtcttgatgtgctcttctaccgcaatgtggaa
gaaggtcgtctcaagttcactacgaatctggcggagggcatcaagggagccgaagtgatt
ttcctggccctgccgacgcctccgggtgaagacggctcggccgacctaaaatacatcctg
ggggttgccaacgaccttggccctatcctggagcaatacgccgttatcgttgacaagagt
acggtgcccgttgggacggccgagaaagtacatgccgggattgccaagaatgcgaaggtt
gatttcgacgtggtgtcgaaccccgaattcctgcgggaaggggtagccgtggaagatttc
atgaagcccgaccgcgtggtgatcggtacgaagtcagacaaggcaaaggcggtgatgaac
cggctttatgcgccgctggtgcggcagggtaaccccgtgattttcatggatgagcgctcg
gccgagatgaccaaatacgccgccaacgcgtttctggccaccaagattacgttcatgaac
gagatcgccaacctctgcgagaaagtaggggccaacgtcgacgatatccgtaaaggtatc
ggtaccgacagccgcatcggcaaacgtttcctgtttgccggcatcgggtatggtggtagc
tgcttccccaaagacgtgcaggcgctggccaaaacggcgcaggagtacgactatgatttc
cgcgtgttgaaatcagtaatggacgtgaatgccggtcagaagaaacggctgttgcccgtg
atcaagcagcattttgggggcgatctgaaaggcaaaaccatcgcgatctgggggctggcc
ttcaaaccctacaccgatgatattcgggaggcgcccgccctcgataacattcgcgatctc
ctggccgaaggcgccaaaatcacggcttatgaccccgaggcgatggaaaatgtgcgtaat
atcctgggtaatcaggtgacgttcgcgcacacgtcgtacgccgccctcgacgatgccgac
gcgctggtgatcatgaccgaatggccgatgttccgcacgccggagttcgaaaaaatgaat
ctgttgctcaaaaacaaagtcatcttcgacgggcgtaacgtctacgaactcgatcagatg
cgcgaactgggctacacctactattcgattggccgcgaagcggtaacgcattaa

DBGET integrated database retrieval system