KEGG   Fibrella aestuarina: FAES_2810Help
Entry
FAES_2810         CDS       T02429                                 

Gene name
pldA
Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
fae  Fibrella aestuarina
Pathway
fae00564  Glycerophospholipid metabolism
fae00565  Ether lipid metabolism
fae00590  Arachidonic acid metabolism
fae00591  Linoleic acid metabolism
fae00592  alpha-Linolenic acid metabolism
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    FAES_2810 (pldA)
   00565 Ether lipid metabolism
    FAES_2810 (pldA)
   00590 Arachidonic acid metabolism
    FAES_2810 (pldA)
   00591 Linoleic acid metabolism
    FAES_2810 (pldA)
   00592 alpha-Linolenic acid metabolism
    FAES_2810 (pldA)
Enzymes [BR:fae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     FAES_2810 (pldA)
    3.1.1.32  phospholipase A1
     FAES_2810 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: CCH00819
UniProt: I0K9L6
Position
complement(3486100..3487008)
Genome map
AA seq 302 aa AA seqDB search
MKHPLCWLITLLGSGLCGSPCHAQKDPLFAKKPVFGTLSDRWELDSATRRGTFLITPYKP
LYVTAGRWSSDPNEQPVSENPTYNYPFYIPLGRYEARWQLSLKVKALQGIFGKHGDLWVG
YTQKSHWQVYNTTFSRPFRETNYEPEAILNFATNFPLLGLRTRMVGIALNHQSNGRAVPL
SRSWNRVILHAGFERGRWTVLLRPWLRLPDAEDENPAITDNIGRADATVIYHTDRHMFSV
VGSHSLRGGTRNRGQVQFDWTFPVTGNLRGDLQILHGYGETLIDYNHRQTTIGLAVSLVN
WL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcctttatgctggcttatcacgctgctcggcagtggcctgtgtggctcgccc
tgccacgcgcagaaagaccccctgtttgccaagaagcccgtgtttggcaccttgtcggat
cggtgggaactggactcggccacgcgccggggtacgttcctgattacgccttacaagccc
ctgtacgtgacagccggacgctggtcgagcgaccccaacgaacagcccgtcagcgaaaac
cccacctacaactatccgttctatatcccgttgggccgctatgaagcccgctggcaattg
agcctcaaagtgaaggccttacagggcatttttggcaagcacggcgatctgtgggtgggc
tacacgcaaaaatcgcactggcaggtctataacacgacgttctcgcggcccttccgcgaa
accaactacgaaccggaggcgattctcaacttcgccaccaattttccgttgctggggcta
cggacccggatggtcggcatcgccctgaaccatcagtcaaacgggcgggccgtgccgctg
tcgcgcagttggaaccgggtgattctgcacgccggttttgagcggggccggtggaccgtg
ctgcttcgtccgtggttacggctccccgatgccgaagacgaaaacccggcgatcacggac
aacatcggccgggccgatgcgacggtcatctaccacacagaccgccatatgttttcggtg
gtgggtagtcactccctccggggcgggacgcgcaaccgggggcaggttcagttcgactgg
acgtttccggtgacgggaaacctgcgcggcgaccttcagattttacatggctacggcgaa
accctcatcgactacaaccaccgccagaccaccatcggcctagccgtatcgcttgtcaac
tggctataa

DBGET integrated database retrieval system