KEGG   Fibrella aestuarina: FAES_3786Help
Entry
FAES_3786         CDS       T02429                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fae  Fibrella aestuarina
Pathway
fae00260  Glycine, serine and threonine metabolism
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01130  Biosynthesis of antibiotics
fae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FAES_3786
Enzymes [BR:fae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FAES_3786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3 NAPRTase_C
Motif
Other DBs
NCBI-ProteinID: CCH01793
UniProt: I0KCE0
Position
4685364..4686377
Genome map
AA seq 337 aa AA seqDB search
MPDFRSDTVTRPTPAMLAAMMAAPVGDDVFGEDPTVNALEQKAASLFGMEAALFCTSGTM
TNQLAIRTHVRPGDEVICDQLSHVYLYEGGGIAVNALASVALLAGERGKLTPELIAPAIN
NPADVHRPISRLVCLENTVNKGGGAYYTVPEIAAIRQLCDERGLALHLDGARLFNALVET
GDAPEAYGRLFHSISICLSKGLGCPVGSLLLGSGTFIAQARRFRKLMGGGWRQAGFLAAA
GIYALDHHVERLKVDHSRARQLGQLLAKQPEVVEVLPVDTNIVIGRLTDGLSSAEYVDRL
AQRGIKAVSFGPQLVRFVTHLDLTDADMAAFETAMQA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatttccgcagcgataccgtaacccgcccaacacccgccatgctggccgctatg
atggccgcccccgttggcgatgatgtctttggcgaagacccaaccgtaaatgccctcgaa
cagaaagccgccagcctgtttggcatggaagcggccctgttttgtacctccggcacgatg
accaaccaactcgccatccgcacgcacgtgcgccccggcgacgaggtgatttgcgatcag
ctctcgcacgtgtacctctacgaaggcggtggcattgccgtcaatgcgctggcctcggta
gcgctgctggcgggcgagcggggcaagctcacgcccgaactcatcgcgcccgcgatcaac
aacccagccgacgtacaccggcccatctcgcggctggtgtgcctcgaaaacaccgtcaac
aaaggtggtggggcttattataccgtcccggagattgcggccatccgtcagctgtgcgac
gaacgcggtctggcgctgcacctcgacggcgcccggctgttcaacgcgctggtcgaaacc
ggcgatgcccccgaagcctacggtcggttgtttcattcgatcagcatttgtttgtcgaaa
gggctgggttgcccggtggggtcgctgttgttgggctcaggtacgttcattgcccaggcg
cggcggttccgcaagctcatgggcggtggctggcgacaggccggtttcctggcggcggcg
ggcatttacgccctcgaccaccacgtcgaacgcctgaaagtcgaccattcgcgcgcccgg
caactgggtcagctgctggcgaaacaacccgaggtggtcgaggtgctccccgtcgatacc
aacatcgttatcgggcggctcaccgacggtctcagcagcgccgagtacgtcgaccggctg
gcgcagcgcggcatcaaggcggtctcgttcgggccgcagctggtgcgcttcgtgacccac
ctcgacctgacagacgccgacatggccgcgtttgaaacggccatgcaggcgtaa

DBGET integrated database retrieval system