KEGG   Fibrella aestuarina: FAES_3838Help
Entry
FAES_3838         CDS       T02429                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
fae  Fibrella aestuarina
Pathway
fae00790  Folate biosynthesis
fae01100  Metabolic pathways
fae02020  Two-component system
Module
fae_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FAES_3838
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FAES_3838
Enzymes [BR:fae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FAES_3838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: CCH01845
UniProt: I0KCJ2
Position
4751917..4753659
Genome map
AA seq 580 aa AA seqDB search
MASKQTINRRDFIEKSALGSLILSTVLVGSCTKDPDPGPTDPNQQGSFAHGVASFDPTDN
QIILWTRVSPTNASSTKVSLTYQLATDSGFRTVVKTEAVDALADDDFTVSIDLSGLSSNT
PYFYRFTITGTDTTSVVGETRTLPKGAERNEVKIAFCSCSNYPAGLFNVYGAIAASDADV
VLHLGDYIYEYGAGQYGSNPTTIGLNRAHLPANEILTLDDYRTRFKQYRTDAQLQLAHQK
KPFICVWDDHEVANDAWKDGAQNHQANEGAFSTRKANALKAYHEYIGIRTLVDAQIYRSF
TFGNILNLHMLDTRLIGRDKQLDYTAYVNSAGQLDTAAFQRDWLNPQRTMLGSAQLSWLG
QALGSGTAAWQVLGQQVLMAKMYLPIELLLSITQAEAESTQGTISPATIQRVQSQVLELT
GLKSRALAKDPTLTPQELARVNTVLPYNLDAWDGYPAEREAVYALAKGKKLIALAGDTHN
AWYSDLLANGGALVGREVATPSVTSPGFEGIVGNNPTILSIFEQALMLLIDDLQYANISK
KGYSMITFSPGRAVSEWRYVENITAPNTATTVGRTETITG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaaacagacaattaaccgccgcgactttatcgaaaaatcggcactgggtagc
ctcattctgtctaccgtgctggtgggtagctgtaccaaagatccagaccctggccccacc
gaccccaaccaacagggtagctttgcccacggtgtcgccagtttcgacccaaccgataat
cagatcatcctctggacgcgcgtttcgcccacaaacgcctcgtctactaaagtgtcccta
acgtaccagctggctaccgacagcggcttccggacggtcgttaagaccgaagccgtcgac
gcgctggccgacgatgatttcaccgtcagcatcgacctgagcgggctgtcgtccaacacg
ccctacttctaccgttttactattaccggcaccgataccacgtcggtagtaggcgaaacc
cggacgctgcccaaaggcgctgagcgcaacgaagtaaaaattgccttctgctcgtgctcc
aactacccggcgggcctgttcaacgtgtatggggccattgccgcctccgacgccgacgta
gtgctgcacctgggcgattacatctatgaatacggtgccggtcagtacggctccaacccg
accaccattggcctgaaccgggcgcacctgcccgccaacgagattctgacgctcgacgat
taccggacgcgcttcaaacagtaccgcaccgacgcgcagttacaactggcgcatcagaaa
aagccgtttatctgcgtctgggacgaccatgaagtggctaacgacgcctggaaagatggc
gcccagaaccatcaggcgaatgaaggcgcgttcagcacccgcaaggccaacgcgctgaaa
gcttatcacgagtacatcggcatccgcacgctggtcgacgcgcaaatctaccgcagcttc
acgtttggcaacatcctgaacctgcacatgctcgatacgcggttgattgggcgggataag
caactcgattacaccgcctacgtgaacagcgcgggccagctggatacggccgctttccag
cgcgactggctcaatccgcagcgcaccatgctcggcagtgcgcagctcagctggctgggg
caggcgctggggtcaggcacggcagcctggcaggtgctggggcaacaggtattgatggcc
aagatgtatttgcccatcgaactactgctaagcatcacgcaggccgaagccgaaagcaca
cagggcaccatcagcccggccacgattcagcgcgtgcaaagtcaggtgctggaactgacc
ggcctcaagagccgagcgctggcgaaagaccccacgctgaccccgcaggagctagcccgg
gtgaacaccgtgctaccctacaacctggacgcctgggacggctacccggccgaacgcgaa
gcggtctatgcgctggccaaaggcaaaaaactgattgcgctggccggcgacacgcacaac
gcctggtattccgatctgctggccaacggcggggcactcgtcgggcgggaagtggctacg
ccctcagttacctcgccgggatttgaaggcattgtcggtaacaatccaaccattctgagc
atctttgagcaggcgctgatgctgctgatcgacgatttgcaatacgccaatatttcgaag
aaaggctattcgatgatcaccttcagcccgggccgggccgtatcggaatggcggtacgtc
gagaacatcacggcgccaaacaccgccacgactgtgggccgtaccgaaaccattacgggg
tag

DBGET integrated database retrieval system