KEGG   Fibrella aestuarina: FAES_4276Help
Entry
FAES_4276         CDS       T02429                                 

Definition
(GenBank) cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
fae  Fibrella aestuarina
Brite
Enzymes [BR:fae01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     FAES_4276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 Cytochrome_C7 Cytochrom_C1
Motif
Other DBs
NCBI-ProteinID: CCH02276
UniProt: I0KDS3
Position
complement(5269713..5270807)
Genome map
AA seq 364 aa AA seqDB search
MRGWQGIGLAVSVALWGWVVGCKQTPTTEPVKPEPPVTPSTGTPLNWQKPANFPDPTYDF
ANNPLTKEGVLLGRTLFYDALLSKDGTISCAFCHSPFTGFSHTDHPLSHGIRDQTGTRNV
PGIQNLAWRNTFFWDGGIIDLDLLPIAPIQNPIEMDETFPNVLTKVRTSGRYRPLFRAAF
GSDSISSDRFLKALSQFMLTMVSSNSTYDKVARKEGGAALTEAAQRGLTLFQQKCASCHK
EPFFTDQGFRNNGLPQLATAKIDDKGRYAITAQDADLYKFRVPSLRNVEFTPPYMHDGRF
SSLQQVLRHYATGVQDSPYLDPLLKQNGQVGIPMTVQEQNDIISFLYTLTDYTFLQNPDL
QPLR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaggggatggcagggcatcggattggctgtgagtgtggcgctctggggctgggtggtt
ggctgcaagcaaacgcccaccaccgaacccgtcaagcccgaaccacccgttaccccatcg
acgggcacgccgctcaattggcagaaacccgccaattttcctgatccaacgtacgatttt
gccaataacccgctcaccaaagagggcgtgctgcttggccggacgctcttctacgatgcg
ctgctgtcgaaagacggcaccatttcgtgcgctttctgccactcgccttttaccggtttt
tcgcataccgaccacccgctgagccacggcatccgcgaccagacgggtacccgcaacgta
cctggcattcagaacctggcctggcgcaacacgtttttctgggatggcggcatcatcgac
ctcgatctgctgcccatcgcacccatacagaatcccatcgagatggacgaaacgttcccc
aacgtgctgacgaaggtgcggacgagtgggcgttaccggcccctgtttcgggcggcgttt
ggctcggattccatcagcagcgaccggtttctgaaggcgctctcgcagttcatgctgacg
atggtatcgagcaattcgacgtatgataaagtggcgcggaaggaggggggcgcggcactg
acagaggctgctcagcgcggactgacgctgtttcagcaaaagtgcgccagttgccataaa
gagccgttttttaccgaccagggcttccgtaacaacggcctgcctcaactggccaccgcc
aaaatcgacgataagggtcggtacgccatcacggcgcaggacgctgacctgtacaagttt
cgggtgccgagtctgcgcaacgtagaatttacgccgccttacatgcacgacggccggttt
tcgagcctgcaacaagtgttgcgccactacgccaccggcgttcaggacagcccctacctt
gaccccctgttgaaacaaaacggtcaggtcggtattccgatgacggtgcaggagcagaac
gacattatctcgtttctgtacacgctgaccgattataccttcctgcaaaaccctgatcta
cagccgttgaggtga

DBGET integrated database retrieval system