KEGG   Fibrella aestuarina: FAES_4937Help
Entry
FAES_4937         CDS       T02429                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fae  Fibrella aestuarina
Pathway
fae00010  Glycolysis / Gluconeogenesis
fae00052  Galactose metabolism
fae00500  Starch and sucrose metabolism
fae00520  Amino sugar and nucleotide sugar metabolism
fae00521  Streptomycin biosynthesis
fae01100  Metabolic pathways
fae01110  Biosynthesis of secondary metabolites
fae01120  Microbial metabolism in diverse environments
fae01130  Biosynthesis of antibiotics
fae01200  Carbon metabolism
Module
fae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FAES_4937
   00052 Galactose metabolism
    FAES_4937
   00500 Starch and sucrose metabolism
    FAES_4937
   00520 Amino sugar and nucleotide sugar metabolism
    FAES_4937
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FAES_4937
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FAES_4937
Enzymes [BR:fae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FAES_4937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: CCH02936
UniProt: I0KFN3
Position
complement(6090484..6091395)
Genome map
AA seq 303 aa AA seqDB search
MASAQYLGIDVGGTNVKMGVVDAKTGKITNFYSHDTASWRESGHFMERFADAIAVELYAN
KDVKKVGIGLPGMINRDRTVPLEITAIPELDGVPMVDILTKRFPDVEFFLENDANAAALG
EFYFVEDMNDENYIFITLGTGVGGAAIINKKVFVGGDGNAMEPGHIPSRNGKVLERNIGK
KELLDLATLRRSEFRGKTMLSDDGTISTTGLVAAAAEGDALALAIWAEVGEMLGDALVTM
VRILDIKQILIGGGLSASFDYIMPAVNKQLDYWLTPYYKKSLTVTKATLGNDAGLLGAAS
LCF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagcacagtatttaggtatcgacgtgggtggcaccaacgtcaaaatgggcgtt
gttgacgcgaaaacgggcaaaatcaccaatttttatagccacgacacggccagctggcgc
gaatcgggccatttcatggaacgcttcgccgatgccatcgctgtcgagctgtacgccaat
aaagacgtaaagaaggtgggtatcgggctgccgggcatgatcaaccgcgaccgtacggtc
cctctcgagatcacggccatccccgagctggacggtgtgccgatggtcgatatcctgacc
aagcgcttccccgacgttgaatttttcctggaaaatgacgctaacgccgccgctctgggt
gaattttactttgtggaggacatgaacgatgaaaactacatcttcatcaccctcggcacg
ggcgtaggcggagcagctatcatcaacaagaaagtgtttgttggtggtgacggtaacgcc
atggagcctggccacattccgtcgcgcaacggaaaagtgctggagcgcaacatcggcaag
aaagagttgctcgatctggctacactccgtcgctctgagttcaggggcaagacgatgttg
tctgacgacggcaccatttcgacgacggggctggtggccgctgccgcggaaggcgacgcg
ctggcactggccatctgggctgaagtgggcgagatgctgggcgatgcgctcgtgacaatg
gttcggattctcgacatcaagcaaatcctgatcggcggtggcttgtcggcgtcgttcgac
tacattatgcccgctgttaacaaacaactcgactactggctcacgccttactacaaaaag
agcctgaccgtgacgaaagccacgctggggaatgacgccggcctgctgggtgccgcatcg
ctctgtttttaa

DBGET integrated database retrieval system