KEGG   Frankia alni: FRAAL0882Help
Entry
FRAAL0882         CDS       T00384                                 

Definition
(GenBank) putative Beta-N-acetylglucosaminidase precursor
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fal  Frankia alni
Pathway
fal00520  Amino sugar and nucleotide sugar metabolism
fal01100  Metabolic pathways
fal01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:fal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FRAAL0882
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FRAAL0882
Enzymes [BR:fal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FRAAL0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: CAJ59549
RhizoBase: FRAAL0882
UniProt: Q0RSB5
Position
complement(947399..949285)
Genome map
AA seq 628 aa AA seqDB search
MVTRSVVTGSVVTRRRRRPPRAVVVLLACLLLVAGCFGRDPERTGGDGTRGATPPAPDAL
AAAVDAAHPTASPGTAATADPTPGSATDDAETAWVDSTLARMTPEQRIGQLLMGYVFGTT
PDDRTPAALAGNRTVAGTDTAAAAVRELGLGGVVLFDAAGAGPGALPDNVIAPGQVLGLT
AGLQGAAAIPLLVAADQEQGPVMRIRDGVTLLPDAMAQGASGRVEDARDAARVTGTDLRA
LGINVDFAPDADVNTNPANPVIGERSFGDDPAAVARLTAAAVSGFASAGVAAAPKHFPGH
GSTSVDSHLDLPVVASSRERLDAVDLAPFRAAVAAGAPMVMVGHLLATALDGGSPASLSP
SVVTSLLRRELGFDGVVVTDALNMAAITRRYSPGEAAVRAVLAGDDLLLMPPRLVEARDG
LLAALRSGRIPAGRIDESARRVLRLKWRLAHASPAPAGDGPAVAARVASRSVTLLTQDCG
ILPLRAGAPVTVAGSSTAAARLRAALAARGVVAPAPGTTAPPPGGSAAAGPGGAAETAPV
TIVLAGGAGPPARTGPGTVVVSTATPYHPPTAAAAWLATYSADPASLAALADVLTGAAPP
RGRLPVAATAPSGRPLPRGSGLTALRPC
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaccagatcggtggtgaccgggtcggtggtgaccagacggcggcgccggccgccg
cgggccgtcgtcgtgctgctggcctgcctcctgctggtcgcgggctgcttcgggcgtgat
ccggagcggaccggcggggacggcacccgcggcgccacgcccccggccccggacgcgctc
gccgcggccgtcgacgcggcgcaccccaccgcgtccccggggaccgccgcgacggcggac
cccactccggggtcggcgaccgacgacgcggagacggcgtgggtggactcgacgctcgcg
cggatgacgcccgagcagcggatcggccagttactcatgggctacgtgttcgggacgacg
ccggatgaccgcacgccggccgcactggccggcaaccggacggtcgcgggcacggacacg
gccgccgccgccgtgcgcgagctcggcctcggcggcgtcgtcctgttcgacgccgcaggc
gccgggccgggtgcgttacccgacaacgtcatcgcccccggccaggtcctcggcctcacc
gccgggttacagggcgccgcggccattcccctgctcgtcgccgccgaccaggagcagggg
ccggtgatgcggatccgcgacggggtgaccctgctgcccgacgcgatggcgcagggcgcg
agcggccgcgtcgaggacgcccgtgacgccgcccgggtgaccggcacggacctgcgtgcg
ctcggcatcaacgtcgacttcgcccccgacgcggacgtcaacaccaacccggccaacccg
gtgatcggcgagcggtcgttcggcgacgacccggccgcggtcgcccgcctcaccgccgcg
gccgtgagcggattcgcctcggcgggggtggccgccgccccgaagcacttccccgggcac
ggctcgacgtcggtcgacagccacctcgacctgccggtggtcgcgtcctcccgcgagcgc
ctcgacgccgtcgacctggcaccgtttcgcgccgccgtcgccgccggggcgccgatggtg
atggtcgggcatctgctcgccaccgcgttggacggcgggtcaccggcgtcgctgtccccg
tcggtggtgacctcgctgctgcgccgggagctcggcttcgacggcgtggtcgtcaccgac
gcgctgaacatggcagccatcaccaggcggtactcgcccggcgaggccgccgtgcgggcc
gtgctcgccggcgacgacctgctgctgatgccgccgcggctcgtcgaggcccgcgacggc
ctgctcgccgcgctgcgcagcggccggatcccggccggccgcatcgacgaatcggcgcgg
cgcgtgctgcgcctgaagtggcgcctcgcgcatgcctccccggcgccggccggtgacgga
cccgccgtggccgcccgggtcgcgtcccggtccgtcactctcctgacgcaggactgcggg
atcctccccctgcgcgcgggcgccccggtcacggtcgccggctcgtccaccgcggccgcc
cgcctgcgcgcggccctcgccgcccggggagtcgtcgccccggcgccgggcaccaccgcg
ccgccccccggcggatccgccgccgcgggccccggcggcgccgctgaaaccgccccggtg
acgatcgtcctcgcgggaggcgccgggccgcccgcccgcaccggccccggcacggtcgtc
gtctccacggccacgccctaccacccgccgaccgccgccgccgcgtggctggccacctac
tccgccgacccggcctccctcgcggccctggccgacgtgctcaccggcgcagccccgccg
cgcggccgcctcccggtcgccgcgaccgccccctcgggccgtcccctcccccgcggctcc
ggcctgaccgcactgcgcccctgctga

DBGET integrated database retrieval system