KEGG   Frankia alni: FRAAL1465Help
Entry
FRAAL1465         CDS       T00384                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
fal  Frankia alni
Brite
KEGG Orthology (KO) [BR:fal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FRAAL1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAJ60121
RhizoBase: FRAAL1465
UniProt: Q0RQQ2
Position
complement(1571144..1572313)
Genome map
AA seq 389 aa AA seqDB search
MRSTTDSVNDGILVLVVLTALAFDFTNGFHDTGNAMATSIATRALPPKVAVALSGALNLV
GAFLSLSVAATIASGLVNTHIVTLTVVFAGLVGGITWNLLTWFFGIPSSSSHALIGGVIG
ATMAAAGTDGVKWHGVVSKVIIPAGLSPVIAALIATVGTYLIYRLSRGVPDRTRSHGFRI
GQIGSASLVSLAHGTNDAQKTMGVITLALIANGTVDAGSKAPFWVILSCALAISLGTYLG
GWRVIRTLGKGLVEIDSPQGMAAESSSAATILLSSHFGYSLSTTHVATGSILGTGLGRKG
AEVRWSVAGRMATAWLFTLPAAGLVGAGCYGIAQGIGGTPGVVIVFVLLVIASVLLYLRA
RRTPVSHHNVNDEWDGATAPADAKESVAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtctacaacagacagcgtgaacgacggcatcctggttttggtggtcctgaccgcg
ctggccttcgacttcacaaacgggttccatgataccggcaacgcgatggcgacctcgatc
gcgacgcgggcgctgcccccgaaggtcgccgtcgccctgtccggggcactgaatctcgtc
ggcgcgttcctgtcgctcagcgtggccgcgacgatcgcaagtggcctggtcaacacccat
atcgtcacgctgacggtggtcttcgcgggcctggtgggcggcattacctggaatttgctg
acctggttcttcggaataccgtcgagttcatctcacgccctcatcggcggggtcatcggg
gcgaccatggccgccgccggcacggacggcgtcaaatggcatggcgtcgtgtcgaaggta
atcattccggccggcctttccccggtgatcgccgccctcatcgcgaccgtgggaacctac
ctgatctaccggctcagtcgcggtgtcccggaccggacgcgcagccacggattccggatc
ggccagatcggctcggcgtcgctcgtctcgctcgcgcacggcacgaacgacgcgcagaag
acgatgggcgtcatcaccctggccctcatcgccaacggcacggtggacgccggctccaag
gccccgttctgggtgatcctgagctgcgcgctcgcgatcagcctcggtacctacctcggt
ggttggcgggtgatccggaccctcggcaagggactggtcgagatcgactccccgcagggc
atggccgccgagtcgtcctcggccgcgacgatcctgctttccagccacttcgggtactcc
ctgtcgacgacgcacgtggcgacgggctcgatcctcggcaccggcctgggccgcaagggc
gccgaggtgcggtggagcgtcgccggtcggatggcgaccgcgtggctgttcaccctgccg
gccgccgggctcgtcggcgccggatgctacgggatcgcccagggcatcggcggcaccccc
ggcgtggtgatcgtcttcgtgctgctggtgatcgcgtccgtcctgctgtacctgcgagcc
cgccggacaccggtcagccaccacaacgtcaacgacgagtgggacggcgcgaccgccccc
gcggacgccaaggagtcggtcgcggcctga

DBGET integrated database retrieval system