KEGG   Frankia alni: FRAAL1637Help
Entry
FRAAL1637         CDS       T00384                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fal  Frankia alni
Pathway
fal00010  Glycolysis / Gluconeogenesis
fal00071  Fatty acid degradation
fal00350  Tyrosine metabolism
fal00625  Chloroalkane and chloroalkene degradation
fal00626  Naphthalene degradation
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FRAAL1637
  Lipid metabolism
   00071 Fatty acid degradation
    FRAAL1637
  Amino acid metabolism
   00350 Tyrosine metabolism
    FRAAL1637
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FRAAL1637
   00626 Naphthalene degradation
    FRAAL1637
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FRAAL1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 IGFBP
Motif
Other DBs
NCBI-ProteinID: CAJ60292
RhizoBase: FRAAL1637
UniProt: Q0RQ84
Position
1757918..1758949
Genome map
AA seq 343 aa AA seqDB search
MTRHQSAPELVEVPDPVPGPGQVRLRVAAAGACHSDLHLMEWPAEQMVGQGLRLPFTLGH
ESAGWVDAVGAGVSAVRVGDACAVYGPWGCGHCRACARGAEQYCEVTHGMGGPGLGGDGG
MAEYLLVDDVRHLVPLGDLDPVAAAPLTDAGLTPYHAIRKALPLLGPGSTAVVIGAGGLG
HLGIQILRAITSARVVAVDVAPGKLVQALALGAHAAVPAGEDAAAAIRAQTVGGLGAQAV
FDMVGSAATMATAAAAVGAEGRITVVGLAGGALPFRFGTVPFDVDVSLPYWGTRGELFEV
LDLARAGLIRAHVETVPLAGMPAAYDRLRAGDVSGRIVMVPSA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcaccagtcggctcccgagctcgtcgaggtgcccgaccccgtccccgggccg
ggtcaggtgcggctgcgggtggccgccgccggtgcctgccacagcgacctgcacctgatg
gaatggccggcggagcagatggtcgggcagggtctgcgcctgccgttcaccctcggccac
gagtccgccggctgggtcgacgccgtgggcgccggggtcagcgcggtgcgggtgggtgac
gcctgcgccgtctacgggccctggggctgcgggcactgccgagcgtgcgcccgcggcgcc
gaacagtactgcgaggtcacccacgggatgggtggcccgggcctcggtggggacggcggt
atggccgagtacctgctcgtcgacgacgtgcgccacctcgtcccgctcggcgacctcgac
ccggtggccgccgcgccgctcaccgacgccgggctcaccccgtatcacgcgatccgcaag
gcgctgccgctgctcgggccgggctcgaccgcggtggtgatcggggccggcggcctcggt
cacctcggcatccagatcctgcgggcgatcacctcggcccgcgtcgtcgccgtcgacgtc
gccccgggcaagctcgtccaggcgctggctctcggcgcgcacgcggcggtgccggcgggc
gaggacgcggccgccgcgatccgggcgcagaccgtcggcggactgggcgcgcaggccgtg
ttcgacatggtcggcagcgccgcgacgatggccaccgccgcggctgccgtcggggccgag
ggacggatcaccgtcgtgggcctggccggcggggcgctgccgttccggttcgggacggtg
ccgttcgacgttgacgtctcgctgccgtactggggcacccgcggcgaactgttcgaggtc
ctcgacctcgcccgcgccggcctgatccgcgcccacgtcgagaccgtcccgctggccggc
atgcccgccgcctacgaccgcctgcgcgcgggcgacgtctccggccgcatcgtcatggtc
ccctcggcctga

DBGET integrated database retrieval system