KEGG   Frankia alni: FRAAL2107Help
Entry
FRAAL2107         CDS       T00384                                 

Definition
(GenBank) CysQ protein homolog
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fal  Frankia alni
Pathway
fal00920  Sulfur metabolism
fal01100  Metabolic pathways
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    FRAAL2107
Enzymes [BR:fal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     FRAAL2107
Transfer RNA biogenesis [BR:fal03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    FRAAL2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: CAJ60756
RhizoBase: FRAAL2107
UniProt: Q0RNY0
Position
2300023..2300856
Genome map
AA seq 277 aa AA seqDB search
MTDSVPMNTDDTRRPATVPVDIATDELDDDVLARRLATDAGKLLLRIREEVGFAEPATLR
DAGDARSHQLLARALARHRPQDAVLSEEGADDPARLSAERVWIVDPLDGTREFAEPGRSD
WAVHVALWRAGELIAGAVALPALNVTLSAGGDAPAAARPAAAGPPRIVASRTRAPRIVGE
VAEALGASVVPMGSAGAKAAAVIRGRAEIYLHAGGQYEWDSAAPVAVARAVGLHTSRLDG
SPLRYNQPDLLLPDLVICEASLAPAVLAAIRAADPRP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgacagactccgtcccgatgaacaccgacgacacccgccggccggccaccgtccccgtc
gacatcgcgaccgacgaactcgacgacgacgtcctggcccggcgactggccacggatgca
ggcaaactgctgctcagaatccgggaggaggtcgggttcgcggagcccgccaccctgcgc
gacgccggcgacgcgcgttcccatcagctcctggcccgggcgctggcccgccaccgcccg
caggacgcggtgctgtcggaggagggcgccgacgacccggcccgactgtccgccgagcgg
gtctggatcgtcgacccgctcgacggcacccgtgagttcgccgaacccggccggtccgac
tgggcggtgcacgtcgcgttgtggcgcgccggcgagctcatcgccggcgcggtcgccctg
ccggcgctgaacgtgacgctgtcggccggcggcgatgctccggccgcggcccggcccgcc
gcggcgggtccgccgcggatcgtcgccagccgcacccgggcgccgcggatcgtcggggag
gtcgccgaggcgctgggcgccagcgtcgtcccgatggggtcggccggggcgaaggccgcg
gcggtcatccgcggccgggcggagatctacctgcacgccggcgggcagtacgagtgggac
tccgcggccccggtggcggtcgcgcgggcggtggggctgcacaccagccgcctcgacggc
tcccccctgcggtacaaccagcccgacctcctgctgcccgacctggtcatctgtgaggcg
agcctggccccggcggtgctcgcggcgatccgggcggccgacccacggccgtga

DBGET integrated database retrieval system