KEGG   Frankia alni: FRAAL2525
Entry
FRAAL2525         CDS       T00384                                 

Definition
(GenBank) Putative short-chain dehydrogenase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
fal  Frankia alni
Pathway
fal00903  Limonene and pinene degradation
fal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fal00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FRAAL2525
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     FRAAL2525
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Hydrolase DUF4791
Other DBs
NCBI-ProteinID: CAJ61172
RhizoBase: FRAAL2525
UniProt: Q0RMS5
Position
complement(2743899..2744792)
AA seq 297 aa
MPGMVSEWNRRVGTENRSHMTGRVAGKVAFITGAARGQGRSHAVRLAEEGADIIAMDICR
SIQGVPYDGPSPEDLAETVKQVERLDRRIVAIEADVRDQEAVSAALARGLDRFGRLDIVA
ANAGISSAPHPAQDIPDDVWTTMLDINLSGVWRTCRAAIPHLVAAGHGGAIVLTSSAAGL
QPYANVAHYVSAKHGVVGLMRALALELAPHNIRVNTLHPTQVDTPMIMNDSTYRLFRPDL
SHPTREDFAPASQAMNALPLPWVEARDVSNALLFLASDEARYITGVALPVDAGALIT
NT seq 894 nt   +upstreamnt  +downstreamnt
gtgccggggatggtcagcgaatggaacagacgagtgggaacggagaaccgcagtcacatg
acgggacgggtagcaggcaaggtcgccttcatcaccggcgccgcacgagggcagggacgc
agccacgccgtccggttggccgaggagggcgcggacatcatcgccatggacatctgccgg
tcgattcagggtgtgccctacgacgggccgtccccggaggacctcgccgagacggtgaag
caggtcgagcggttggaccgacgcatcgtcgcgatcgaggccgacgtgcgcgaccaggag
gcggtgtcggccgcgctcgctcggggactcgaccggttcggccggctcgacatcgtcgcg
gcgaacgccgggatcagctcggcaccgcatcccgcgcaggacatccccgacgacgtgtgg
accacgatgctcgacatcaacctcagcggcgtgtggcgcacgtgcagggcggccatcccg
cacctggttgcggcgggccacggcggggcgatcgtcctgacgagctcggcggcggggctg
cagccgtatgcgaacgtcgcgcactacgtctcggcgaagcacggcgtggtgggcctgatg
cgcgcgctcgcgctcgagctggcgccacacaacatccgggtgaacaccctgcatcccacc
caggtggacactccgatgatcatgaatgactcgacctaccggctgttccggcccgacctg
tcgcacccgacccgcgaggacttcgcgccggcctcgcaggccatgaacgccctgcccctt
ccgtgggtcgaggcccgggatgtcagtaacgcactgttgttcctggcctcggacgaggcg
cgctacatcaccggcgtcgcgctgccggtcgacgccggagccctgatcacctga

DBGET integrated database retrieval system