KEGG   Frankia alni: FRAAL3218Help
Entry
FRAAL3218         CDS       T00384                                 

Definition
(GenBank) putative acid phosphatase
  KO
K21302  phosphatidylinositol-3-phosphatase [EC:3.1.3.64]
Organism
fal  Frankia alni
Pathway
fal00562  Inositol phosphate metabolism
fal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    FRAAL3218
Enzymes [BR:fal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     FRAAL3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: CAJ61862
RhizoBase: FRAAL3218
UniProt: Q0RKU3
Position
3500504..3501388
Genome map
AA seq 294 aa AA seqDB search
MSVLTRVRRSRLALGSLGAASLAAAVFGVWAAAPAQAAGLPAPDHVVVVMLENHSYSQVI
GSSSAPYINSLKSGGANLTASYALTHPSQPNYVALFSGGTQGITDDACYTPGFSSAANLG
SELIAAGKTFGSYNEGLPSAGSTVCTNSATKYARKHNPWFAFSNVPTSTAHTFAQFPTNY
STLPKVSFVIPNLCNDMHDCSVATGDTWLQNNLGAYATWAKTHNSVLVVTFDEDNSQSGN
RIPTVFYGQHVTAGSSTSTTYNHYNLLRTLEDLGGLTTHAGNASSASDITGIWS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgttctcacccgtgtccggcgttcgcgcctggcgctgggctccctcggcgcggcc
agcctggcggccgccgtgttcggagtgtgggctgccgcccccgcccaggccgcgggtctg
cccgcgcccgaccacgtcgtcgtcgtgatgctcgagaaccacagctactcgcaggtcatc
ggatcgtcgagtgcgccctacatcaactcgctgaagagcggcggcgcgaacctcaccgcg
tcctacgccctgacccatcccagccagcccaactacgtcgcgctgttctccggcggcacc
cagggcatcaccgacgacgcctgctacaccccgggattcagcagcgccgccaacctcggc
tccgaactcatcgccgccggcaagacgttcggcagctacaacgagggcctgccgtcggcc
gggtcgacggtctgcacgaacagcgccaccaagtacgcccgcaagcacaacccgtggttc
gccttcagtaacgtgccgacgagcaccgcgcacaccttcgcccagttcccgacgaactac
tcgacgctgccgaaggtctcgttcgtcatcccgaacctgtgcaacgacatgcacgactgc
tcggtcgccacgggcgacacctggctgcagaacaacctcggcgcctacgccacctgggcg
aagacccacaacagcgtgctcgtggtgaccttcgacgaggacaactcgcagagcggcaac
cgcatccccacggtgttctacggccagcacgtcaccgcgggcagcagcacgtcgacgacc
tacaaccactacaacctgctgcgcaccctggaggacctcggcgggctgacgacgcacgcc
ggcaacgcgtcgagcgcgtcggacatcaccggcatctggagctaa

DBGET integrated database retrieval system