KEGG   Frankia alni: FRAAL4219
Entry
FRAAL4219         CDS       T00384                                 
Name
(GenBank) conserved hypothetical protein (Putative membrane protein)
Organism
fal  Frankia alni
SSDB
Motif
Pfam: Scramblase DUF2510
Other DBs
NCBI-ProteinID: CAJ62861
RhizoBase: FRAAL4219
UniProt: Q0RI11
Position
complement(4584205..4585122)
AA seq 305 aa
MTQTIPPGWYADPSGQHGSRWWDGSQWTEHTQPPPGQGGGYGQGGEYGPGGQIGQYGQDQ
AAAVPGQAWGAPLGVQPGAVYTKHSAEQVQRQVQEQAGVQPAGPGGGTLFSEPVLVVNQK
SKIIEVTNEYAVFDQGGKQIGSVVEVGQSALKKAARVLTSWDQFFSHRLEVRDAAGTVQL
LLHRPAKVFKSKVIVSLPDGSELGVIAQQNVFGKIRFDLQAGGTTIGAIKAENWRAWNFS
IVDQNDVEVARVTKTWEGLARAMFTTADNYVVQLHRPLPQPLHSMVVAAALTIDTALKQD
SRGLG
NT seq 918 nt   +upstreamnt  +downstreamnt
atgacgcaaaccatcccgcccggctggtacgccgatccgagcgggcagcacggatcccga
tggtgggacggaagccagtggaccgagcacacccagccgccccccggccagggcgggggg
tacggccagggcggggagtacggccccggcgggcagatcggccagtacgggcaggaccag
gccgcggccgttccggggcaggcgtggggcgcgccactgggagtgcagccgggcgcggtg
tacacgaagcacagcgccgagcaggtgcagcggcaggtccaggagcaggccggggtgcaa
ccggcgggcccgggtggggggacgctgttcagcgagcccgtgctcgtggtcaaccagaag
tccaagatcattgaagtgaccaacgagtacgccgtcttcgaccagggcggcaaacagatc
ggctcggtcgtcgaggtcggccagagcgcgctgaagaaggctgcccgggtgctcacctcg
tgggaccagttcttctcccaccgcctggaggtccgcgacgccgccggtaccgtccagctg
ctcctgcaccgcccggcgaaggtgttcaagtccaaggtgatcgtctcgttgccggacggg
tccgagctcggcgtcatcgcgcagcagaacgtcttcggcaagatccggttcgacctgcag
gcgggcggcacgacgatcggcgcgatcaaggccgagaactggcgggcgtggaacttctcg
atcgtcgaccagaacgacgtcgaggtcgcccgggtcaccaagacctgggagggcctcgcg
cgggcgatgttcaccacggccgacaactacgtcgtccagcttcaccggccgctgccgcag
ccgctgcacagcatggtcgtcgccgccgccctcaccatcgacacggcgctcaagcaggat
tcccgcggcctcggctga

DBGET integrated database retrieval system