KEGG   Frankia alni: FRAAL5152Help
Entry
FRAAL5152         CDS       T00384                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase, component of 2-oxoglutarate dehydrogenase complex (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fal  Frankia alni
Pathway
fal00020  Citrate cycle (TCA cycle)
fal00310  Lysine degradation
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01130  Biosynthesis of antibiotics
fal01200  Carbon metabolism
Module
fal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FRAAL5152 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    FRAAL5152 (sucB)
Enzymes [BR:fal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FRAAL5152 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAJ63792
RhizoBase: FRAAL5152
UniProt: Q0RFF3
Position
5584285..5585790
Genome map
AA seq 501 aa AA seqDB search
MRGACRMRRRSRSSMSVSVTMPRLGESVSEGTVTRWLKQEGERVEADEPLLEVSTDKVDT
EIPAPASGVISSIKVAEDETVEVGVELAVIDDGSGGGSAAAAPTEAPAPAAEPEPEPEPA
KPVAAAPPPPPAPTPAPAPAPVRAPEPAPVPAQAPTAPAPVATSNGDGGIGRYVTPLVRK
MAAELGVDLADVNGSGPGGRITKQDIQEAARSGGAPAAPAPAAAPAAPAAPSAPARPAAP
TAAPAASAPKASGAGTSTPAPVRGRTEKLSRLRALVAKRMVESLQISAQLTTVVEVDVTR
IARLRDRAKAGFQAREGLKLSFLPFFALATCEALREFPQLNASLDVEAGTVTYHGEENLG
IAVDSERGLVVPVIHSAGDLNLTGLARKIDDLASRTRANKISPDELGGGTFTLTNTGSRG
ALFDTPIINQPQVGILGTGIVTKKPAVIDDPELGEIIAVRSAVYLSLTYDHRIVDGADAA
RFLTFIKRRLEEGAFEADLGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcggtgcatgccggatgcgacgaaggagtcgttccagcatgtctgtatctgtcacg
atgccccggctcggggaaagtgtctccgagggaaccgtcacccgttggctgaagcaggag
ggtgagcgcgtcgaggccgacgagccgctcctcgaggtcagcacggacaaggtcgacacc
gagattcctgcccccgcctccggtgtcatcagctccatcaaggtcgcggaggacgagacc
gtcgaggtcggcgtcgaactcgcggtcatcgacgacggctccggcggcggttccgccgcg
gccgcccccaccgaggcccccgcccccgccgcggagcctgagccggagcccgagccggcc
aagcccgtcgccgcggcgcccccgcccccgcccgcacccaccccggcccccgcgccggcg
ccggtccgcgcgccggagccggccccggtgcccgcccaggccccgaccgcgcccgccccg
gtggccacgtccaacggcgacggcgggatcggtcgctacgtcacgccgctggtccgcaag
atggccgccgagctgggcgtcgacctcgccgacgtgaacggctcgggccccggcggccgg
atcaccaagcaggacatccaggaggcggcccgctccggcggcgccccggccgctcccgcg
cccgccgccgccccggcggctccggccgcgccgtcggcaccggcccgccccgcggcgccg
accgcggccccggccgcgtccgccccgaaggcgagcggcgcgggcacctccacccccgcc
ccggtccgcgggcgcaccgagaagctctcccggctgcgcgccctggtcgccaagcgcatg
gtcgagtcgctgcagatcagcgcccagctcaccaccgtcgtcgaggtggacgtcacccgc
atcgcgcggctgcgggaccgggccaaggccggcttccaggcccgcgagggactgaagctg
tcgttcctgccgttcttcgcgctggcgacctgcgaggcgctgcgcgagttcccgcagctc
aacgccagcctcgacgtcgaggcggggacggtcacctaccacggcgaggagaacctcggc
atcgccgtggactccgagcgcggcctggtcgtaccggtcatccacagcgccggtgacctc
aacctcaccggtctcgcccgcaagatcgacgacctggccagccggacccgggccaacaag
atctccccggacgagctcggcggcgggaccttcaccctcacgaacaccggcagccggggc
gccctgttcgacactccgatcatcaaccagccgcaggtcggcatcctcggcacggggatc
gtgacgaagaagcccgccgtcatcgacgaccccgagctcggcgagatcatcgccgtccgg
tcagcggtgtacctgtcgctgacctacgaccaccgcatcgtcgacggggccgacgccgcc
cgcttcctgaccttcatcaagcggcggctcgaggagggcgcgttcgaggccgacctcggc
ctctag

DBGET integrated database retrieval system