KEGG   Frankia alni: FRAAL5454Help
Entry
FRAAL5454         CDS       T00384                                 

Definition
(GenBank) hypothetical protein
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAJ64087
RhizoBase: FRAAL5454
UniProt: Q0REM1
Position
5902544..5902843
Genome map
AA seq 99 aa AA seqDB search
MPIFPSDTPDPRPTPGADLPLIVASIVRPGVYALTVRPGADARDLGEAMSRLPVDAFLTE
HFGDIDLTMVFRAVPGGPNSEPTGGTTPTAPAAASGTRP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcttcccgtccgacaccccggacccccgcccgacccccggcgcagacctgccg
ctgatcgtggccagcatcgtccgacccggcgtgtacgcgctgacggttcgccccggcgcc
gacgcccgcgacctcggtgaggcgatgtcccgcctgccggtcgacgccttcctgaccgag
cacttcggcgacatcgacctgaccatggtctttcgcgcggtgcccggcggtccgaactcc
gagcccaccgggggcaccaccccgacggcaccggcggcggcgagcggaacccgcccgtag

DBGET integrated database retrieval system