KEGG   Frankia alni: FRAAL6507Help
Entry
FRAAL6507         CDS       T00384                                 

Definition
(GenBank) Terpene cyclase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
fal  Frankia alni
Pathway
fal00909  Sesquiterpenoid and triterpenoid biosynthesis
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fal00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    FRAAL6507
Enzymes [BR:fal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     FRAAL6507
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     FRAAL6507
    4.2.3.75  (-)-germacrene D synthase
     FRAAL6507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: CAJ65130
RhizoBase: FRAAL6507
UniProt: Q0RBQ4
Position
7075397..7077673
Genome map
AA seq 758 aa AA seqDB search
MQPFTLPEFYVPYPARLSPHLEQAREHSREWARAMEMIDTPQHGIAIWTERDLDAHDYAL
LCAYTHPDATADRLNLITDWYVWVFYFDDHFLELYKRSHDLAGARAYLDRLPAFMPVDGE
ITEEPSNPVERGLADLWTRTVPARSADWRARFAVSTRNLLDESLWELENINAARLSNPIE
YIEMRRKVGGAPWSANLVEHAADAEVPARVAATRPLQVLRDTFADAVHLRNDLFSYEREV
TEEGELSNGVLVVERFLDIDTQAAADTVNDLLTSRLHQFEHTAATELPAVLDEHAIDPAG
RLAALAYIKGLQDWQSGGHEWHLRSSRYMNREATPDAVPPGLGPLAGLGGTGSLVPAAGL
PGIPGIPSLGTSAIQVLPSLLATAPRRIRSFANVPFRLVGPTPLPEFYLPYTTGLSPHLD
SSRRAIIPWARSMGMLDRVPGIWDEHKLWSYDFALCSAGIHPDATADELDLTTAWLTWGT
YGDDYYPVIFGASRNLAAAKLCNERLRLFMPVDGPLTEPPVNALERGLADLWERTGAGME
PAARATFRRTIEVMIDSWLWELANQAHNRIPDPVDYLEMRRATFGSDLTMSLCRLARWHS
VPAEVFGTRPLRALENAAADYACLLNDIFSYQKEIQFEGEIHNCVLVVENFLDCDRGRAV
EVVNALMTARMRQFEHVVDRELPDLFDRLDLDGEARAAIVSYARELQNWLAGILRWHQGT
HRYEEAELRYHPAADRRPFGSPTGLGTSAADVRRLASR
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctttcaccctccccgagttctacgtgccctatcccgcacggctcagtccgcat
cttgaacaggcccgggaacacagcagggagtgggcccgggcgatggagatgatcgacacg
ccccagcacggcatcgcgatctggaccgaacgggacctcgacgcccacgactacgccctg
ctgtgcgcctacacccatcccgacgccaccgccgatcgcctcaatctgatcaccgactgg
tacgtctgggtcttctacttcgacgaccacttcctcgagctctacaagcggtcgcacgac
ctggccggtgcccgggcctacctcgaccggctccccgcgttcatgccggtggacggcgag
atcaccgaggagccgtcgaacccggtggagcggggcctggccgacctgtggacacggacc
gtgccggcccgctcggccgactggcgggcccgcttcgccgtcagcacccgcaacctgctc
gacgagtccctctgggaactcgagaacatcaacgccgcccggctgtccaacccgatcgag
tacatcgagatgcgccgcaaggtcggcggcgccccgtggtcggcgaacctcgtcgagcac
gccgccgacgccgaggtccccgcccgcgtcgccgccacccgcccgttgcaggtgctgcgc
gacaccttcgccgacgcggtgcacctgcgcaacgacctgttctcctacgaacgcgaggtc
accgaggagggcgagctcagcaacggggtgctggtcgtggagcggttcctggacatcgac
acgcaggccgccgccgacaccgtcaacgacctgctgacctcccggctgcaccagttcgag
cacaccgccgccacggaactgccggccgtcctcgacgagcacgccatcgacccggcgggc
cggctggcggcgctggcgtacatcaagggtctgcaggactggcagtccggcgggcacgag
tggcacctgcgctccagccgctacatgaaccgcgaggcgacacccgacgcggtcccgccc
ggcctcgggccgctcgccgggctcggggggacgggcagcctcgtccccgccgccgggctg
cccggcatcccggggatccccagcctcggcacctcggccatccaggtccttccgtcgctg
ctcgccaccgcaccgcggcggatccggtccttcgccaacgtgccgttccggctcgtcggc
ccgaccccgctgccggagttctacctgccctacaccaccggactgagcccccatctggac
tcctcgcgacgcgcgatcatcccctgggcgcgctcgatggggatgttggaccgggtgccg
ggcatctgggacgaacacaagctctggtcctacgacttcgccctgtgctcggcgggcatc
catccggacgcgaccgccgacgagctcgacctcacgacggcctggctcacctgggggacc
tacggggacgactactacccggtgatcttcggcgcgtcccggaacctggccgcggcgaag
ctgtgcaacgagcgcctgcggctgttcatgccggtcgacggtccgctgaccgagccgccg
gtcaacgccctggaacgcggcctcgccgacctgtgggaacggaccggtgccgggatggag
cccgccgcgcgggccacgttccgccggacgatcgaggtgatgatcgacagctggctgtgg
gagctggccaaccaggcccacaaccgcatccccgatcccgtcgactacctggagatgcgc
cgcgcgaccttcggctcggacctgacgatgagcctgtgccggctggctcgctggcacagc
gtgccggcggaggtcttcgggacccggccgctgcgggcgctggagaacgccgccgcggac
tacgcctgcctgctcaacgacatcttctcctaccagaaggagatccagttcgaaggcgag
atccacaactgtgtgctggtcgtcgagaacttcctcgactgcgaccgcggccgggccgtc
gaggtggtcaacgcgctcatgaccgcccggatgcggcagttcgagcacgtcgtggaccgt
gagctgcccgatctgttcgaccgcctcgacctcgacggcgaggcccgcgcggcgatcgtc
tcctacgcccgggaactgcagaactggttggccggcatcctgcgatggcaccaagggacg
caccgatacgaggaggccgaactgcgctaccaccccgctgccgacaggcggcccttcggt
agcccgaccgggctaggcacctccgccgccgacgttcgccggctcgcgtcccgctga

DBGET integrated database retrieval system