KEGG   Ferriphaselus amnicola: OYT1_ch0145Help
Entry
OYT1_ch0145       CDS       T05631                                 

Definition
(GenBank) Divalent-cation tolerance protein CutA
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
fam  Ferriphaselus amnicola
Brite
KEGG Orthology (KO) [BR:fam00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    OYT1_ch0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-ProteinID: BBE49721
UniProt: A0A2Z6G8D6
Position
complement(143596..143925)
Genome map
AA seq 109 aa AA seqDB search
MEPALIVLTNLPDRATAERLAHALITSRAAACVNILAECSSIYRWQDAVEQANEIPLLIK
TTVAAYPCVEQTIRELHPYELPEIVAVPVVAGLPAYLAWVAQETTPNTL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgcactgatcgtcctcaccaacctacctgatcgagccaccgccgagcgactg
gcccatgcgctcatcaccagccgcgccgccgcttgcgtcaatatcctagccgaatgcagt
tcgatctatcgctggcaagacgcggtggagcaggcgaacgagattcctctgctcatcaaa
accacggtcgccgcttacccctgcgtggagcaaacgatacgcgaactccatccttatgaa
cttcccgagatcgtggctgtccctgtcgttgccggcttgcccgcctatctggcttgggtc
gcgcaagaaaccacacccaatacactatga

DBGET integrated database retrieval system