KEGG   Ferriphaselus amnicola: OYT1_ch2137Help
Entry
OYT1_ch2137       CDS       T05631                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
fam  Ferriphaselus amnicola
Pathway
fam00020  Citrate cycle (TCA cycle)
fam00620  Pyruvate metabolism
fam01100  Metabolic pathways
fam01110  Biosynthesis of secondary metabolites
fam01120  Microbial metabolism in diverse environments
fam01200  Carbon metabolism
Module
fam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OYT1_ch2137
   00620 Pyruvate metabolism
    OYT1_ch2137
Enzymes [BR:fam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     OYT1_ch2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BBE51662
UniProt: A0A2Z6GE96
Position
complement(2105655..2107136)
Genome map
AA seq 493 aa AA seqDB search
MSVTHVDVLLVGGGVMSATLGTLLAQLAPELKMVMVERLDQVAHESTDGWSNAGTGHAGY
CELNYTPQAADGSVEVKRALAINADFEVTLQFLSYLVERGLLPPPATFINRVPHLSFVWG
EEDVTFLRKRYEAMRRHAQFSDMQFSDDPDVLRQWMPLVMAQRDVSQPVAATRVEYGSDI
DFGALTRGMVETLKRQPNFNLLLEHSVRSLEQDKHGHWHVHVHDRASNKSKTFVSRFVFL
GAGGGALPLLQKSGIPESKGYGGFPVSGQWLICNDPEIVQQHHAKVYGKAPLGAPPMSVP
HLDTRIINGQRALLFGPYAGFTTKFLKQGSYLDLLKSVSPFNLKPMMSAGWSNVDLTRYL
IGEALQSPKQRNKALRNIYPQAHVRDWSLANAGKRVQVIKGYDKGVGKLEFGTEVVVAQD
GTLATLLGASPGASIAPPAMIQIIERCFADKLKADEWQQRLREMMPSYGVSLTEEPELLA
KVRGRNLRVLGLG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcactcatgttgatgtactgctggtaggtggcggtgtgatgagcgcgacgctg
ggtacgttgttggcgcaactcgcacctgagttgaagatggtgatggtcgagcgtctcgat
caggtcgcccatgaaagtaccgatggctggagtaatgcaggaaccggccatgcgggttat
tgcgagctgaactacacaccgcaggcagcggatggctcggtcgaggtcaagcgggcattg
gcgatcaacgctgattttgaggtgacgctgcaattcctgagttacctagtagagcgcggt
ctgttgccgccacccgctacgttcatcaaccgagtgccgcatctgagttttgtctggggt
gaggaggatgtgactttcttgcgtaaacgctacgaggcgatgcgcagacacgcacagttt
tccgacatgcagttcagcgatgatcccgacgtgttgcgtcagtggatgcctttggtgatg
gcgcagcgtgatgtctcccagcctgtcgctgctactcgggtcgaatatggttcggacatc
gactttggtgcgttgacacgcggcatggtggagacgctgaagcggcaaccgaacttcaat
cttctgctcgaacattcggtgcgctcgctcgaacaggataagcatggccactggcacgtc
catgtgcatgatcgcgcgagtaataagagcaagaccttcgtcagccgtttcgtctttctc
ggcgcgggcggtggtgcgttgccgctgttgcaaaaatcgggcatccctgagagcaagggc
tatggtggctttcctgtcagtgggcaatggctgatttgtaacgaccccgagatcgttcag
cagcatcacgccaaggtatatggcaaggctccactcggagcgccgccgatgtcggtgccg
catctggatacgcgcatcatcaacggccagcgggcactactgttcggcccctacgcgggg
tttaccaccaaattcctgaagcagggctcgtacctggatctgctgaaatcagtcagtccg
ttcaatcttaagccgatgatgtcggcgggctggagtaacgtcgatctcactcgctatctc
atcggagaggcgcttcagtcgcctaagcaacgcaacaaggccttgcgcaacatctatccg
caagcgcatgtgcgcgattggtcgctggccaacgcaggtaagcgggtgcaagttatcaag
ggctatgacaagggtgtgggcaagttggaattcggtacggaagtcgttgtcgcgcaagat
ggcacactagcgactttgctgggagcatctccgggtgcatctatcgcaccgccagcgatg
atccagatcatcgaacgttgtttcgcggataagctgaaggcggatgagtggcaacagcgg
ctgcgggagatgatgccaagttacggcgtctctttgacggaggagccggagttgctagct
aaggtacgaggtcgaaatctgcgggtgctcggcttgggttaa

DBGET integrated database retrieval system