KEGG   Fictibacillus arsenicus: ABE41_011535Help
Entry
ABE41_011535      CDS       T04452                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
far  Fictibacillus arsenicus
Pathway
far00380  Tryptophan metabolism
far01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:far00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ABE41_011535
Enzymes [BR:far01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     ABE41_011535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Hs1pro-1_C YfdX
Motif
Other DBs
NCBI-ProteinID: ANX12641
UniProt: A0A1B1Z5F9
Position
complement(2246688..2247536)
Genome map
AA seq 282 aa AA seqDB search
MTEQKKLDSKETEKGIYTDFINQMTYGEYLQLDQILSSQKRLSGHHDEMLFIIIHQVSEL
WMKLILHETRSAISSIENGNLHSAFKMLARVSKIQSQIIESWDVLSTLTPAEYMEFRDKL
GQASGFQSYQYRMIEFALGYKTPHILEIYKKDADLHEQLTAALHTPSLYDVSIHALAKAG
LYIDKEMLNRDVTKRYEYNNSVEAAWLEVYKNVEKYWDLYELAEKLVDIEDWLQQWRFRH
MKTVERIIGFKVGTGGSSGVNYLKKVLDQRFFPELWDLRTSI
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacagaaaaaattggacagtaaagaaactgaaaaagggatttatactgacttt
attaatcagatgacttatggagaatatcttcagcttgatcaaatcttatcaagtcaaaaa
aggctttctgggcaccatgacgagatgctgtttattatcattcaccaggtaagtgaactt
tggatgaaattaatcttacatgaaacaagatcagctatttcatcaatagaaaacggtaat
ctgcattcagcatttaagatgcttgctcgcgtatcaaagattcagtctcagatcattgaa
tcgtgggatgttctttcaacacttactccagcagaatatatggagttccgcgacaaactt
ggacaagcatctggtttccaatcttatcaatatcgcatgattgaatttgctcttggttat
aaaacgcctcatattttagaaatctataaaaaagatgcagatctgcatgaacagctgaca
gctgctcttcatacacctagtctttatgatgtatcaattcatgcgcttgctaaagcagga
ctctatattgataaagaaatgttaaaccgtgatgtaacgaaacgttatgagtacaataat
tccgttgaagcagcttggcttgaagtctataaaaatgttgaaaagtattgggatctatat
gagcttgcagagaagctagtagacattgaagactggcttcagcagtggcgattccgtcat
atgaaaacagttgagcgaattatcggatttaaagtaggaacaggcggatcatctggtgta
aactacttgaaaaaagtattagatcagcgtttcttccctgagctttgggatttaagaaca
agcatataa

DBGET integrated database retrieval system