KEGG   Fictibacillus arsenicus: ABE41_012245Help
Entry
ABE41_012245      CDS       T04452                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
far  Fictibacillus arsenicus
Pathway
far00071  Fatty acid degradation
far00072  Synthesis and degradation of ketone bodies
far00280  Valine, leucine and isoleucine degradation
far00310  Lysine degradation
far00362  Benzoate degradation
far00380  Tryptophan metabolism
far00620  Pyruvate metabolism
far00630  Glyoxylate and dicarboxylate metabolism
far00640  Propanoate metabolism
far00650  Butanoate metabolism
far00900  Terpenoid backbone biosynthesis
far01100  Metabolic pathways
far01110  Biosynthesis of secondary metabolites
far01120  Microbial metabolism in diverse environments
far01130  Biosynthesis of antibiotics
far01200  Carbon metabolism
far01212  Fatty acid metabolism
far02020  Two-component system
Brite
KEGG Orthology (KO) [BR:far00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABE41_012245
   00630 Glyoxylate and dicarboxylate metabolism
    ABE41_012245
   00640 Propanoate metabolism
    ABE41_012245
   00650 Butanoate metabolism
    ABE41_012245
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABE41_012245
   00072 Synthesis and degradation of ketone bodies
    ABE41_012245
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE41_012245
   00310 Lysine degradation
    ABE41_012245
   00380 Tryptophan metabolism
    ABE41_012245
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABE41_012245
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABE41_012245
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE41_012245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:far04147]
    ABE41_012245
Enzymes [BR:far01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABE41_012245
Exosome [BR:far04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABE41_012245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANX12782
UniProt: A0A1B1Z5R9
Position
complement(2370868..2372040)
Genome map
AA seq 390 aa AA seqDB search
MSIYLIDGARTAFGSFGKSLTDISPTQLGETTAIEAMKRANITPSDVTDVVYGNVIHSSK
NAAYVARHTALKAGVPSSVPAMLVNRLCGSGLQAVVSAMQNLRDHEGGIALCGGIENMSQ
SPHASFTHRFHNQKFGAISFEDMLLQTLSDEYIGCGMGITAENLAKQYNISREEQDEYAS
HSHQKAAAASESGRFKDEIVSVPLKNDEFFTEDEGIKPQTTSSKLGQLRPSFQKDGTVTA
GNSSSINDGAVSLILAHEKDIKEKKLNPLAEIVSWAVTGVDPNVMGIGPVPAIRMALDRA
ELSIDDIGLFEINEAFSSQYLAVEKELKLDRGRTNVNGGAIALGHPVGASGARLLLTLAY
EMKKRNETYGAASLCIGGGQGIAMILKLAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctacttaattgatggtgccagaacggcatttggttcttttggaaaatcatta
acagatatatccccgacacagcttggagaaacaacagcaatcgaagcgatgaagcgtgcc
aacataactccctcggatgtaacagatgtggtatacggaaatgttattcactctagtaaa
aatgctgcttatgttgcgcgtcatacagcgctaaaggcaggtgttccttcaagtgttcct
gcaatgctggtcaacaggctatgcggatcgggactgcaagctgttgtctctgccatgcag
aatctacgagatcatgaaggcggcatagcattatgcggtggaattgaaaacatgtcacag
tctcctcatgcttcatttactcaccggtttcacaatcaaaaattcggtgcaatctctttt
gaggatatgctgcttcaaacacttagtgatgagtatataggatgcgggatgggaattact
gcagaaaatttagcaaaacagtataacatctcgagagaagaacaagatgaatatgcaagc
catagtcatcaaaaagctgcagcagcaagtgaaagcggaagatttaaagatgagatcgtg
tcggtacctttaaaaaatgatgagttttttacagaagatgaaggaattaaaccgcagaca
acctcttcaaaacttggccagctgcgtccttctttccaaaaagatggaacagtaactgca
ggaaactcttcatctataaatgacggagctgtttctttaattcttgctcatgagaaagat
ataaaagaaaagaaactaaatcctctagcagaaattgtttcatgggctgttacaggagtt
gatcctaatgtcatgggtatcggtccagttcctgcgatcaggatggctttggatagagcg
gaattgtctattgatgatattggcttatttgaaataaatgaagcattcagctcccagtac
ttagctgtggaaaaagagctaaagcttgaccgcggccgaacaaatgtaaatggaggagct
attgcattaggacatcctgttggagcaagcggtgcgaggctcctattaacacttgcatac
gaaatgaagaagcggaatgaaacatacggcgccgcgagtctatgtatcggcggtggccag
gggattgcaatgattttgaaattggcaaaataa

DBGET integrated database retrieval system