KEGG   Fictibacillus arsenicus: ABE41_013565Help
Entry
ABE41_013565      CDS       T04452                                 

Definition
(GenBank) cysteine desulfurase NifS
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
far  Fictibacillus arsenicus
Pathway
far00730  Thiamine metabolism
far01100  Metabolic pathways
far04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:far00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ABE41_013565
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    ABE41_013565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:far03016]
    ABE41_013565
   03029 Mitochondrial biogenesis [BR:far03029]
    ABE41_013565
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:far02048]
    ABE41_013565
Enzymes [BR:far01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     ABE41_013565
Transfer RNA biogenesis [BR:far03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    ABE41_013565
 Prokaryotic Type
    ABE41_013565
Mitochondrial biogenesis [BR:far03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    ABE41_013565
Prokaryotic defense system [BR:far02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   ABE41_013565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANX13035
UniProt: A0A1B1Z6D4
Position
complement(2616965..2618104)
Genome map
AA seq 379 aa AA seqDB search
MKNVYLDHAATSPVHPEVIEEMIPYLTEHFGNPSSIHQFGRRARKVLDDARTTIASSINA
ARNEIIFTSGGTESDNLAILGTASALMEKGKHVITTRVEHHAVLHTFHELEKRGFKVTYL
SVDKNGRISLDELKASLREETILVSIMYCNNETGTTQDIKEIGSLLKEKNIIFHTDAVQA
YGLIPIDVAELNVDLLSASGHKINSPKGTGFLYVKESVPFLPQGFGGEQERKRRAGTENV
AGIAALNKAAALAMKERDERFAQYMNYRDTMKKIWDEESIQYLENGSNEYFLPHILNVSF
PGVKTEVLLVNLDIAGIAASSGSACTAGSHEPSHVLAAMFGEDERTKSSVRFSFGLGNEL
EDIEYAARETAKIVKRLAK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtttatttggatcacgctgcaacatcacctgttcatcctgaagtgatcgaa
gagatgatcccatatttaacggaacattttggaaatccttctagcatacatcaattcgga
agacgtgcacgcaaagttcttgatgatgctcgtactactatagcctcttctattaatgct
gcccgcaatgaaattatatttactagcgggggaacagaaagtgataatctggcaatactg
ggcacagcttcagctttaatggaaaaaggaaaacatgttataacgacaagagttgagcat
catgccgttctccatacctttcatgagctagaaaagagaggctttaaagttacttattta
tcagtcgataagaatggcaggatctcccttgatgaattaaaagcgtcgctgagagaagaa
acgattcttgtttctataatgtattgcaacaatgaaacggggacaacacaagacattaaa
gagatcggaagcttattaaaagagaagaatattatatttcatacggacgctgttcaggca
tatggtctgatacctatagatgttgcagaactgaacgtcgatttattgagtgcgtctgga
cataagatcaacagtccaaaagggacaggctttctatatgtaaaagaatcggtacctttt
cttccccaaggcttcggcggtgagcaagagcgcaaacgccgtgcaggtacagagaatgtc
gcgggaatcgccgcattgaataaagcagccgcgttagcaatgaaagagcgggatgaacgc
ttcgcacaatacatgaattatcgggatacgatgaaaaaaatatgggatgaagagagtatt
caatatttagagaatggcagtaacgaatactttttgccgcatatcttaaatgtcagtttt
cctggagtaaagactgaagtgctcttagttaatctagatatagctggtatcgcagcttcg
agcggatccgcttgtacagctggatctcatgagccttcgcacgtattggctgccatgttt
ggagaagatgaacgtacgaaatcatctgttcgtttcagctttgggttaggcaatgaattg
gaagatattgaatatgctgcccgcgagacagcaaaaatagtgaaacgtttagcaaaataa

DBGET integrated database retrieval system