KEGG   Fictibacillus arsenicus: ABE41_017870Help
Entry
ABE41_017870      CDS       T04452                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
far  Fictibacillus arsenicus
Pathway
far00030  Pentose phosphate pathway
far00480  Glutathione metabolism
far01100  Metabolic pathways
far01110  Biosynthesis of secondary metabolites
far01120  Microbial metabolism in diverse environments
far01130  Biosynthesis of antibiotics
far01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:far00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABE41_017870
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABE41_017870
Enzymes [BR:far01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     ABE41_017870
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     ABE41_017870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD F420_oxidored 2-Hacid_dh_C 3HCDH_N UDPG_MGDP_dh_N GFO_IDH_MocA TrkA_N NAD_binding_11 IlvN PDH DapB_N Rossmann-like
Motif
Other DBs
NCBI-ProteinID: ANX13883
UniProt: A0A1B1Z8W7
Position
complement(3525175..3526071)
Genome map
AA seq 298 aa AA seqDB search
MKIGLIGLGKMGYNLVLNMTNKGHEVVAHDVSEEAMNKIASEGVETAASFEEMISKLPTP
KIVWLMVPAGDITEDVMNRVSSLLSEQDIIIDGGNANYKDTLRRGNDLKEKGIYLIDSGT
SGGMDGARDGVCTMIGGDKEAFDQVEKLFQDISVENGYLYTGKSGSGHFLKMVHNGIEYG
MMQAIAEGYEILEKSDFDYDYEEVSRVWNNGSVIRSWLIELMQNAFSKDAKLDSLRGVMN
SSGEGKWTVETALDLQAVAPVITLSQIMRYRSQENDTFSGKVVAALRNEFGGHAVVKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtttaatcggtttaggaaaaatgggttataatttggttttgaatatgact
aataaaggtcatgaagtagtggctcacgatgttagtgaagaagcaatgaataaaatcgcc
agtgaaggtgttgaaacagcggcatcttttgaggaaatgatcagtaagcttccaacacct
aaaatcgtttggttaatggttccagcaggcgacattactgaagatgttatgaatcgtgtc
tcctcacttctatctgaacaagatattattattgatggtggaaatgcaaattacaaagac
acactccgtcgaggaaatgatttaaaggaaaaaggaatatatcttatagattccggtact
agcggcggtatggacggagcaagagacggtgtctgcacgatgattggcggagataaagag
gcttttgatcaagtcgagaagttatttcaagatatctcagttgaaaacggatacctctac
acaggcaagtctggaagcggacatttccttaagatggttcacaatggtattgaatatggg
atgatgcaggctattgcggaaggctatgaaatcctagagaaaagcgattttgattacgat
tacgaagaggtttcacgagtttggaataatggatctgtcattcgctcttggctgatcgaa
ctcatgcagaatgctttttcaaaagatgcaaagcttgatagtttaagaggtgtaatgaac
tcatctggggaaggtaaatggaccgttgaaactgcacttgatttgcaagctgttgcacct
gtcattacattatctcaaatcatgagataccgttctcaagaaaacgatacattctctgga
aaagtggttgcagcacttcgaaacgaattcggtggacatgctgtagtaaaaaaataa

DBGET integrated database retrieval system